You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07660
Secondary Accession Numbers
  • 13369
Name Desmoglein-3
Synonyms
  1. 130 kDa pemphigus vulgaris antigen
  2. Cadherin family member 6
  3. PVA
Gene Name DSG3
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
plasma membrane
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Process
cell adhesion
cellular process
cell-cell adhesion
homophilic cell adhesion
Cellular Location
  1. Cell membrane
  2. Single-pass type I membrane protein
  3. Cell junction
  4. desmosome
Gene Properties
Chromosome Location Chromosome:1
Locus 18q12.1
SNPs DSG3
Gene Sequence
>3000 bp
ATGATGGGGCTCTTCCCCAGAACTACAGGGGCTCTGGCCATCTTCGTGGTGGTCATATTG
GTTCATGGAGAATTGCGAATAGAGACTAAAGGTCAATATGATGAAGAAGAGATGACTATG
CAACAAGCTAAAAGAAGGCAAAAACGTGAATGGGTGAAATTTGCCAAACCCTGCAGAGAA
GGAGAAGATAACTCAAAAAGAAACCCAATTGCCAAGATTACTTCAGATTACCAAGCAACC
CAGAAAATCACCTACCGAATCTCTGGAGTGGGAATCGATCAGCCGCCTTTTGGAATCTTT
GTTGTTGACAAAAACACTGGAGATATTAACATAACAGCTATAGTCGACCGGGAGGAAACT
CCAAGCTTCCTGATCACATGTCGGGCTCTAAATGCCCAAGGACTAGATGTAGAGAAACCA
CTTATACTAACGGTTAAAATTTTGGATATTAATGATAATCCTCCAGTATTTTCACAACAA
ATTTTCATGGGTGAAATTGAAGAAAATAGTGCCTCAAACTCACTGGTGATGATACTAAAT
GCCACAGATGCAGATGAACCAAACCACTTGAATTCTAAAATTGCCTTCAAAATTGTCTCT
CAGGAACCAGCAGGCACACCCATGTTCCTCCTAAGCAGAAACACTGGGGAAGTCCGTACT
TTGACCAATTCTCTTGACCGAGAGCAAGCTAGCAGCTATCGTCTGGTTGTGAGTGGTGCA
GACAAAGATGGAGAAGGACTATCAACTCAATGTGAATGTAATATTAAAGTGAAAGATGTC
AACGATAACTTCCCAATGTTTAGAGACTCTCAGTATTCAGCACGTATTGAAGAAAATATT
TTAAGTTCTGAATTACTTCGATTTCAAGTAACAGATTTGGATGAAGAGTACACAGATAAT
TGGCTTGCAGTATATTTCTTTACCTCTGGGAATGAAGGAAATTGGTTTGAAATACAAACT
GATCCTAGAACTAATGAAGGCATCCTGAAAGTGGTGAAGGCTCTAGATTATGAACAACTA
CAAAGCGTGAAACTTAGTATTGCTGTCAAAAACAAAGCTGAATTTCACCAATCAGTTATC
TCTCGATACCGAGTTCAGTCAACCCCAGTCACAATTCAGGTAATAAATGTAAGAGAAGGA
ATTGCATTCCGTCCTGCTTCCAAGACATTTACTGTGCAAAAAGGCATAAGTAGCAAAAAA
TTGGTGGATTATATCCTGGGAACATATCAAGCCATCGATGAGGACACTAACAAAGCTGCC
TCAAATGTCAAATATGTCATGGGACGTAACGATGGTGGATACCTAATGATTGATTCAAAA
ACTGCTGAAATCAAATTTGTCAAAAATATGAACCGAGATTCTACTTTCATAGTTAACAAA
ACAATCACAGCTGAGGTTCTGGCCATAGATGAATACACGGGTAAAACTTCTACAGGCACG
GTATATGTTAGAGTACCCGATTTCAATGACAATTGTCCAACAGCTGTCCTCGAAAAAGAT
GCAGTTTGCAGTTCTTCACCTTCCGTGGTTGTCTCCGCTAGAACACTGAATAATAGATAC
ACTGGCCCCTATACATTTGCACTGGAAGATCAACCTGTAAAGTTGCCTGCCGTATGGAGT
ATCACAACCCTCAATGCTACCTCGGCCCTCCTCAGAGCCCAGGAACAGATACCTCCTGGA
GTATACCACATCTCCCTGGTACTTACAGACAGTCAGAACAATCGGTGTGAGATGCCACGC
AGCTTGACACTGGAAGTCTGTCAGTGTGACAACAGGGGCATCTGTGGAACTTCTTACCCA
ACCACAAGCCCTGGGACCAGGTATGGCAGGCCGCACTCAGGGAGGCTGGGGCCTGCCGCC
ATCGGCCTGCTGCTCCTTGGTCTCCTGCTGCTGCTGTTGGCCCCCCTTCTGCTGTTGACC
TGTGACTGTGGGGCAGGTTCTACTGGGGGAGTGACAGGTGGTTTTATCCCAGTTCCTGAT
GGCTCAGAAGGAACAATTCATCAGTGGGGAATTGAAGGAGCCCATCCTGAAGACAAGGAA
ATCACAAATATTTGTGTGCCTCCTGTAACAGCCAATGGAGCCGATTTCATGGAAAGTTCT
GAAGTTTGTACAAATACGTATGCCAGAGGCACAGCGGTGGAAGGCACTTCAGGAATGGAA
ATGACCACTAAGCTTGGAGCAGCCACTGAATCTGGAGGTGCTGCAGGCTTTGCAACAGGG
ACAGTGTCAGGAGCTGCTTCAGGATTCGGAGCAGCCACTGGAGTTGGCATCTGTTCCTCA
GGGCAGTCTGGAACCATGAGAACAAGGCATTCCACTGGAGGAACCAATAAGGACTACGCT
GATGGGGCGATAAGCATGAATTTTCTGGACTCCTACTTTTCTCAGAAAGCATTTGCCTGT
GCGGAGGAAGACGATGGCCAGGAAGCAAATGACTGCTTGTTGATCTATGATAATGAAGGC
GCAGATGCCACTGGTTCTCCTGTGGGCTCCGTGGGTTGTTGCAGTTTTATTGCTGATGAC
CTGGATGACAGCTTCTTGGACTCACTTGGACCCAAATTTAAAAAACTTGCAGAGATAAGC
CTTGGTGTTGATGGTGAAGGCAAAGAAGTTCAGCCACCCTCTAAAGACAGCGGTTATGGG
ATTGAATCCTGTGGCCATCCCATAGAAGTCCAGCAGACAGGATTTGTTAAGTGCCAGACT
TTGTCAGGAAGTCAAGGAGCTTCTGCTTTGTCCACCTCTGGGTCTGTCCAGCCAGCTGTT
TCCATCCCTGACCCTCTGCAGCATGGTAACTATTTAGTAACGGAGACTTACTCGGCTTCT
GGTTCCCTCGTGCAACCTTCCACTGCAGGCTTTGATCCACTTCTCACACAAAATGTGATA
GTGACAGAAAGGGTGATCTGTCCCATTTCCAGTGTTCCTGGCAACCTAGCTGGCCCAACG
CAGCTACGAGGGTCACATACTATGCTCTGTACAGAGGATCCTTGCTCCCGTCTAATATGA
Protein Properties
Number of Residues 999
Molecular Weight 107532.1
Theoretical pI 4.61
Pfam Domain Function
Signals
  • 1-23
Transmembrane Regions
  • 616-640
Protein Sequence
>Desmoglein-3
MMGLFPRTTGALAIFVVVILVHGELRIETKGQYDEEEMTMQQAKRRQKREWVKFAKPCRE
GEDNSKRNPIAKITSDYQATQKITYRISGVGIDQPPFGIFVVDKNTGDINITAIVDREET
PSFLITCRALNAQGLDVEKPLILTVKILDINDNPPVFSQQIFMGEIEENSASNSLVMILN
ATDADEPNHLNSKIAFKIVSQEPAGTPMFLLSRNTGEVRTLTNSLDREQASSYRLVVSGA
DKDGEGLSTQCECNIKVKDVNDNFPMFRDSQYSARIEENILSSELLRFQVTDLDEEYTDN
WLAVYFFTSGNEGNWFEIQTDPRTNEGILKVVKALDYEQLQSVKLSIAVKNKAEFHQSVI
SRYRVQSTPVTIQVINVREGIAFRPASKTFTVQKGISSKKLVDYILGTYQAIDEDTNKAA
SNVKYVMGRNDGGYLMIDSKTAEIKFVKNMNRDSTFIVNKTITAEVLAIDEYTGKTSTGT
VYVRVPDFNDNCPTAVLEKDAVCSSSPSVVVSARTLNNRYTGPYTFALEDQPVKLPAVWS
ITTLNATSALLRAQEQIPPGVYHISLVLTDSQNNRCEMPRSLTLEVCQCDNRGICGTSYP
TTSPGTRYGRPHSGRLGPAAIGLLLLGLLLLLLAPLLLLTCDCGAGSTGGVTGGFIPVPD
GSEGTIHQWGIEGAHPEDKEITNICVPPVTANGADFMESSEVCTNTYARGTAVEGTSGME
MTTKLGAATESGGAAGFATGTVSGAASGFGAATGVGICSSGQSGTMRTRHSTGGTNKDYA
DGAISMNFLDSYFSQKAFACAEEDDGQEANDCLLIYDNEGADATGSPVGSVGCCSFIADD
LDDSFLDSLGPKFKKLAEISLGVDGEGKEVQPPSKDSGYGIESCGHPIEVQQTGFVKCQT
LSGSQGASALSTSGSVQPAVSIPDPLQHGNYLVTETYSASGSLVQPSTAGFDPLLTQNVI
VTERVICPISSVPGNLAGPTQLRGSHTMLCTEDPCSRLI
GenBank ID Protein 119964718
UniProtKB/Swiss-Prot ID P32926
UniProtKB/Swiss-Prot Entry Name DSG3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001944.2
GeneCard ID DSG3
GenAtlas ID DSG3
HGNC ID HGNC:3050
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Ramachandran P, Boontheung P, Xie Y, Sondej M, Wong DT, Loo JA: Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry. J Proteome Res. 2006 Jun;5(6):1493-503. [PubMed:16740002 ]
  3. Nusbaum C, Zody MC, Borowsky ML, Kamal M, Kodira CD, Taylor TD, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Abouelleil A, Allen NR, Anderson S, Bloom T, Bugalter B, Butler J, Cook A, DeCaprio D, Engels R, Garber M, Gnirke A, Hafez N, Hall JL, Norman CH, Itoh T, Jaffe DB, Kuroki Y, Lehoczky J, Lui A, Macdonald P, Mauceli E, Mikkelsen TS, Naylor JW, Nicol R, Nguyen C, Noguchi H, O'Leary SB, O'Neill K, Piqani B, Smith CL, Talamas JA, Topham K, Totoki Y, Toyoda A, Wain HM, Young SK, Zeng Q, Zimmer AR, Fujiyama A, Hattori M, Birren BW, Sakaki Y, Lander ES: DNA sequence and analysis of human chromosome 18. Nature. 2005 Sep 22;437(7058):551-5. [PubMed:16177791 ]
  4. Amagai M, Klaus-Kovtun V, Stanley JR: Autoantibodies against a novel epithelial cadherin in pemphigus vulgaris, a disease of cell adhesion. Cell. 1991 Nov 29;67(5):869-77. [PubMed:1720352 ]