Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07661
Secondary Accession Numbers
  • 13370
Name Desmoglein-4
Synonyms
  1. Cadherin family member 13
Gene Name DSG4
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
plasma membrane
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Process
cell adhesion
cellular process
cell-cell adhesion
homophilic cell adhesion
Cellular Location
  1. Cell membrane
  2. Single-pass type I membrane protein
  3. Cell junction
  4. desmosome
Gene Properties
Chromosome Location Chromosome:1
Locus 18q12.1
SNPs DSG4
Gene Sequence
>3123 bp
ATGGATTGGCTCTTCTTCAGAAACATTTGCCTTTTGATCATTCTAATGGTGGTGATGGAA
GTAAACAGTGAATTTATTGTTGAGGTGAAGGAATTTGACATTGAAAATGGCACTACAAAA
TGGCAAACAGTCAGAAGACAAAAGCGGGAGTGGATCAAGTTTGCCGCAGCCTGTCGAGAA
GGAGAGGACAACTCGAAGAGGAACCCCATTGCCAAAATTCGATCAGACTGCGAATCGAAC
CAGAAGATAACATACCGGATTTCTGGAGTAGGGATTGATCGACCACCATATGGGGTATTC
ACCATTAATCCTCGCACTGGGGAAATTAACATCACTTCAGTGGTAGACAGAGAAATAACT
CCACTTTTCTTGATCTATTGCCGGGCTCTGAATTCACGGGGTGAAGATTTAGAAAGGCCT
CTTGAGCTTAGAGTCAAAGTTATGGACATAAATGATAACGCTCCAGTCTTTTCGCAAAGT
GTATACACAGCCAGCATTGAAGAAAATAGTGATGCCAATACATTGGTAGTAAAGTTATGT
GCCACAGATGCAGATGAAGAAAATCATCTGAATTCTAAAATTGCCTACAAGATCGTCTCT
CAGGAGCCATCAGGTGCACCCATGTTCATTCTGAATAGGTACACTGGAGAAGTCTGCACC
ATGTCCAGTTTCTTGGACAGAGAGCAACACAGTATGTACAACCTGGTTGTGAGAGGCTCA
GATCGGGATGGAGCTGCAGATGGACTGTCTTCTGAGTGTGACTGTAGAATCAAGGTTTTA
GACGTCAACGATAATTTCCCCACCTTAGAGAAAACTTCATACTCAGCCAGTATTGAAGAG
AATTGTTTAAGTTCGGAACTGATACGATTACAAGCAATTGATCTTGATGAAGAAGGCACT
GATAACTGGTTGGCTCAATATTTAATTCTCTCTGGAAATGATGGGAATTGGTTCGATATT
CAAACAGATCCACAAACCAATGAAGGCATTTTGAAAGTTGTCAAGATGCTGGATTATGAA
CAAGCACCTAACATTCAGCTTAGTATCGGAGTTAAAAACCAAGCTGATTTTCACTACTCC
GTTGCTTCTCAATTCCAAATGCACCCAACCCCTGTGAGAATTCAAGTTGTTGATGTGAGA
GAAGGACCTGCATTTCATCCAAGTACTATGGCTTTTAGTGTGCGGGAAGGAATAAAAGGA
AGTTCCTTATTGAATTATGTGCTTGGCACATATACAGCCATAGATTTGGACACAGGAAAC
CCTGCAACAGATGTCAGATATATCATAGGGCATGATGCAGGCAGCTGGTTAAAAATTGAT
TCAAGAACTGGTGAGATACAATTTTCTAGAGAATTTGATAAGAAGTCAAAATATATTATC
AATGGGATATACACAGCAGAGATCCTGGCTATAGATGATGGCTCTGGAAAAACAGCTACA
GGAACCATATGTATTGAGGTTCCTGATATCAATGATTATTGTCCAAACATTTTTCCTGAA
AGAAGAACCATCTGCATTGACTCTCCATCAGTCCTTATCTCTGTTAATGAACATTCTTAT
GGGTCTCCGTTTACTTTCTGTGTTGTTGATGAGCCACCAGGAATAGCTGACATGTGGGAT
GTCAGATCAACAAATGCTACCTCGGCAATCCTTACGGCTAAGCAGGTTTTATCTCCAGGA
TTTTATGAAATCCCAATCCTGGTGAAGGACAGCTATAACAGAGCATGTGAATTGGCACAA
ATGGTGCAGTTATATGCCTGTGATTGCGATGACAACCACATGTGCCTGGACTCTGGTGCC
GCGGGCATCTACACAGAGGACATAACTGGTGACACGTATGGGCCTGTCACTGAAGACCAA
GCTGGAGTTTCAAATGTTGGTCTTGGACCAGCAGGGATTGGCATGATGGTTCTGGGCATC
CTGCTACTGATTTTGGCTCCACTCTTGCTGCTCCTGTGTTGCTGCAAACAGAGACAGCCA
GAAGGCCTGGGAACAAGATTTGCTCCTGTGCCTGAGGGCGGAGAAGGAGTGATGCAGTCT
TGGAGAATTGAAGGGGCCCATCCCGAGGACAGGGATGTGTCAAATATATGTGCACCCATG
ACAGCCTCAAATACCCAGGATCGGATGGATTCCTCTGAAATCTACACCAACACCTATGCA
GCCGGGGGCACGGTGGAAGGAGGTGTATCGGGAGTGGAGCTCAACACAGGTATGGGGACA
GCCGTTGGCCTCATGGCCGCAGGGGCCGCAGGAGCCTCAGGGGCCGCAAGGAAGAGGAGC
TCTACCATGGGAACCCTGCGGGACTACGCTGACGCAGACATCAACATGGCTTTCTTGGAC
AGCTACTTCTCGGAGAAAGCGTATGCTTATGCAGATGAAGATGAAGGTCGACCAGCCAAT
GACTGCTTGCTCATTTATGACCACGAGGGAGTCGGGTCTCCCGTAGGCTCTATTGGTTGT
TGCAGTTGGATTGTGGATGACTTAGATGAAAGCTGCATGGAAACTTTAGATCCAAAATTT
AGGACTCTTGCTGAGATCTGCTTAAACACAGAAATTGAACCATTTCCTTCACACCAGGCT
TGTATACCAATCAGTACTGACCTCCCTTTGCTCGGACCTAATTACTTTGTTAATGAATCT
TCAGGATTGACTCCCTCAGAAGTTGAATTCCAAGAAGAAATGGCAGCATCTGAACCCGTG
GTCCATGGGGATATTATTGTGACTGAGACTTACGGTAATGCTGATCCATGTGTGCAACCC
ACTACAATTATTTTTGATCCTCAGCTTGCACCCAATGTTGTAGTAACCGAAGCAGTAATG
GCACCTGTCTATGATATTCAAGGGAATATTTGTGTACCTGCTGAGTTAGCAGATTACAAC
AATGTAATCTATGCTGAGAGAGTACTGGCTAGTCCTGGTGTGCCTGACATGAGCAATAGT
AGCACGACTGAGGGTTGTATGGGACCTGTGATGAGCGGCAATATTTTAGTAGGGCCAGAA
ATTCAAGTGATGCAAATGATGAGTCCAGACCTTCCCATAGGCCAAACCGTTGGCTCCACA
TCCCCCATGACATCTCGACACAGAGTAACACGATACAGTAACATACATTACACCCAACAG
TAA
Protein Properties
Number of Residues 1040
Molecular Weight 113823.1
Theoretical pI 4.17
Pfam Domain Function
Signals
  • 1-23
Transmembrane Regions
  • 632-652
Protein Sequence
>Desmoglein-4
MDWLFFRNICLLIILMVVMEVNSEFIVEVKEFDIENGTTKWQTVRRQKREWIKFAAACRE
GEDNSKRNPIAKIRSDCESNQKITYRISGVGIDRPPYGVFTINPRTGEINITSVVDREIT
PLFLIYCRALNSRGEDLERPLELRVKVMDINDNAPVFSQSVYTASIEENSDANTLVVKLC
ATDADEENHLNSKIAYKIVSQEPSGAPMFILNRYTGEVCTMSSFLDREQHSMYNLVVRGS
DRDGAADGLSSECDCRIKVLDVNDNFPTLEKTSYSASIEENCLSSELIRLQAIDLDEEGT
DNWLAQYLILSGNDGNWFDIQTDPQTNEGILKVVKMLDYEQAPNIQLSIGVKNQADFHYS
VASQFQMHPTPVRIQVVDVREGPAFHPSTMAFSVREGIKGSSLLNYVLGTYTAIDLDTGN
PATDVRYIIGHDAGSWLKIDSRTGEIQFSREFDKKSKYIINGIYTAEILAIDDGSGKTAT
GTICIEVPDINDYCPNIFPERRTICIDSPSVLISVNEHSYGSPFTFCVVDEPPGIADMWD
VRSTNATSAILTAKQVLSPGFYEIPILVKDSYNRACELAQMVQLYACDCDDNHMCLDSGA
AGIYTEDITGDTYGPVTEDQAGVSNVGLGPAGIGMMVLGILLLILAPLLLLLCCCKQRQP
EGLGTRFAPVPEGGEGVMQSWRIEGAHPEDRDVSNICAPMTASNTQDRMDSSEIYTNTYA
AGGTVEGGVSGVELNTGMGTAVGLMAAGAAGASGAARKRSSTMGTLRDYADADINMAFLD
SYFSEKAYAYADEDEGRPANDCLLIYDHEGVGSPVGSIGCCSWIVDDLDESCMETLDPKF
RTLAEICLNTEIEPFPSHQACIPISTDLPLLGPNYFVNESSGLTPSEVEFQEEMAASEPV
VHGDIIVTETYGNADPCVQPTTIIFDPQLAPNVVVTEAVMAPVYDIQGNICVPAELADYN
NVIYAERVLASPGVPDMSNSSTTEGCMGPVMSGNILVGPEIQVMQMMSPDLPIGQTVGST
SPMTSRHRVTRYSNIHYTQQ
GenBank ID Protein 29789445
UniProtKB/Swiss-Prot ID Q86SJ6
UniProtKB/Swiss-Prot Entry Name DSG4_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_177986.3
GeneCard ID DSG4
GenAtlas ID DSG4
HGNC ID HGNC:21307
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  3. Kljuic A, Bazzi H, Sundberg JP, Martinez-Mir A, O'Shaughnessy R, Mahoney MG, Levy M, Montagutelli X, Ahmad W, Aita VM, Gordon D, Uitto J, Whiting D, Ott J, Fischer S, Gilliam TC, Jahoda CA, Morris RJ, Panteleyev AA, Nguyen VT, Christiano AM: Desmoglein 4 in hair follicle differentiation and epidermal adhesion: evidence from inherited hypotrichosis and acquired pemphigus vulgaris. Cell. 2003 Apr 18;113(2):249-60. [PubMed:12705872 ]
  4. Whittock NV, Bower C: Genetic evidence for a novel human desmosomal cadherin, desmoglein 4. J Invest Dermatol. 2003 Apr;120(4):523-30. [PubMed:12648213 ]
  5. Rafiq MA, Ansar M, Mahmood S, Haque S, Faiyaz-ul-Haque M, Leal SM, Ahmad W: A recurrent intragenic deletion mutation in DSG4 gene in three Pakistani families with autosomal recessive hypotrichosis. J Invest Dermatol. 2004 Jul;123(1):247-8. [PubMed:15191570 ]