Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07663
Secondary Accession Numbers
  • 13372
Name Eukaryotic elongation factor 2 kinase
Synonyms
  1. Calcium/calmodulin-dependent eukaryotic elongation factor 2 kinase
  2. eEF-2 kinase
  3. eEF-2K
Gene Name EEF2K
Protein Type Unknown
Biological Properties
General Function Involved in elongation factor-2 kinase activity
Specific Function Phosphorylates eukaryotic elongation factor-2. Binds calmodulin
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
elongation factor-2 kinase activity
atp binding
calmodulin binding
protein binding
protein kinase activity
protein serine/threonine kinase activity
calcium ion binding
calmodulin-dependent protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 16p12.2
SNPs EEF2K
Gene Sequence
>2178 bp
ATGGCAGACGAAGATCTCATCTTCCGCCTGGAAGGCGTTGATGGCGGCCAGTCCCCCCGA
GCTGGCCATGATGGTGATTCTGATGGGGACAGCGACGATGAGGAAGGTTACTTCATCTGC
CCCATCACGGATGACCCAAGCTCGAACCAGAATGTCAATTCCAAGGTTAATAAGTACTAC
AGCAACCTAACAAAAAGTGAGCGGTATAGCTCCAGCGGGTCCCCGGCAAACTCCTTCCAC
TTCAAGGAAGCCTGGAAGCACGCAATCCAGAAGGCCAAGCACATGCCCGACCCCTGGGCT
GAGTTCCACCTGGAAGATATTGCCACCGAACGTGCTACTCGACACAGGTACAACGCCGTC
ACCGGGGAATGGCTGGATGATGAAGTTCTGATCAAGATGGCATCTCAGCCCTTCGGCCGA
GGAGCAATGAGGGAGTGCTTCCGGACGAAGAAGCTCTCCAACTTCTTGCATGCCCAGCAG
TGGAAGGGCGCCTCCAACTACGTGGCGAAGCGCTACATCGAGCCCGTAGACCGGGATGTG
TACTTTGAGGACGTGCGTCTACAGATGGAGGCCAAGCTCTGGGGGGAGGAGTATAATCGG
CACAAGCCCCCCAAGCAGGTGGACATCATGCAGATGTGCATCATCGAGCTGAAGGACAGA
CCGGGCAAGCCCCTCTTCCACCTGGAGCACTACATCGAGGGCAAGTACATCAAGTACAAC
TCCAACTCTGGCTTTGTCCGCGATGACAACATCCGCCTGACGCCGCAGGCCTTCAGCCAC
TTCACTTTTGAGCGTTCCGGCCATCAGCTGATAGTGGTGGACATCCAGGGAGTTGGGGAT
CTCTACACTGACCCACAGATCCACACGGAGACGGGCACTGACTTTGGAGACGGCAACCTA
GGTGTCCGCGGGATGGCGCTCTTCTTCTACTCTCATGCCTGCAACCGGATTTGCGAGAGC
ATGGGCCTTGCTCCCTTTGACCTCTCGCCCCGGGAGAGGGATGCAGTGAATCAGAACACC
AAGCTGCTGCAATCAGCCAAGACCATCTTGAGAGGAACAGAGGAAAAATGTGGGAGCCCC
CGAGTAAGGACCCTCTCTGGGAGCCGGCCACCCCTGCTCCGTCCCCTTTCAGAGAACTCT
GGAGACGAGAACATGAGCGACGTGACCTTCGACTCTCTCCCTTCTTCCCCATCTTCGGCC
ACACCACACAGCCAGAAGCTAGACCACCTCCATTGGCCAGTGTTCAGTGACCTCGATAAC
ATGGCATCCAGAGACCATGATCATCTAGACAACCACCGGGAGTCTGAGAATAGTGGGGAC
AGCGGATACCCCAGTGAGAAGCGGGGTGAGCTGGATGACCCTGAGCCCCGAGAACATGGC
CACTCATACAGTAATCGGAAGTACGAGTCTGACGAAGACAGCCTGGGCAGCTCTGGACGG
GTATGTGTAGAGAAGTGGAATCTCCTCAACTCCTCCCGCCTCCACCTGCCGAGGGCTTCG
GCCGTGGCCCTGGAAGTGCAAAGGCTTAATGCTCTGGACCTCGAAAAGAAAATCGGGAAG
TCCATTTTGGGGAAGGTCCATCTGGCCATGGTGCGCTACCACGAGGGTGGGCGCTTCTGC
GAGAAGGGCGAGGAGTGGGACCAGGAGTCGGCTGTCTTCCACCTGGAGCACGCAGCCAAC
CTGGGCGAGCTGGAGGCCATCGTGGGCCTGGGACTCATGTACTCGCAGTTGCCTCATCAC
ATCCTAGCCGATGTCTCTCTGAAGGAGACAGAAGAGAACAAAACCAAAGGATTTGATTAC
TTACTAAAGGCCGCTGAAGCTGGCGACAGGCAGTCCATGATCCTAGTGGCGCGAGCTTTT
GACTCTGGCCAGAACCTCAGCCCGGACAGGTGCCAAGACTGGCTAGAGGCCCTGCACTGG
TACAACACTGCCCTGGAGATGACGGACTGTGATGAGGGCGGTGAGTACGACGGAATGCAG
GACGAGCCCCGGTACATGATGCTGGCCAGGGAGGCCGAGATGCTGTTCACAGGAGGCTAC
GGGCTGGAGAAGGACCCGCAGAGATCAGGGGACTTGTATACCCAGGCAGCAGAGGCAGCG
ATGGAAGCCATGAAGGGCCGACTGGCCAACCAGTACTACCAAAAGGCTGAAGAGGCCTGG
GCCCAGATGGAGGAGTAA
Protein Properties
Number of Residues 725
Molecular Weight 82143.5
Theoretical pI 4.98
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Eukaryotic elongation factor 2 kinase
MADEDLIFRLEGVDGGQSPRAGHDGDSDGDSDDEEGYFICPITDDPSSNQNVNSKVNKYY
SNLTKSERYSSSGSPANSFHFKEAWKHAIQKAKHMPDPWAEFHLEDIATERATRHRYNAV
TGEWLDDEVLIKMASQPFGRGAMRECFRTKKLSNFLHAQQWKGASNYVAKRYIEPVDRDV
YFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKDRPGKPLFHLEHYIEGKYIKYN
SNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNL
GVRGMALFFYSHACNRICESMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSP
QVRTLSGSRPPLLRPLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDN
MASRDHDHLDNHRESENSGDSGYPSEKRGELDDPEPREHGHSYSNRKYESDEDSLGSSGR
VCVEKWNLLNSSRLHLPRASAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEGGRFC
EKGEEWDQESAVFHLEHAANLGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFDY
LLKAAEAGDRQSMILVARAFDSGQNLSPDRCQDWLEALHWYNTALEMTDCDEGGEYDGMQ
DEPRYMMLAREAEMLFTGGYGLEKDPQRSGDLYTQAAEAAMEAMKGRLANQYYQKAEEAW
AQMEE
GenBank ID Protein 9558749
UniProtKB/Swiss-Prot ID O00418
UniProtKB/Swiss-Prot Entry Name EF2K_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_013302.3
GeneCard ID EEF2K
GenAtlas ID EEF2K
HGNC ID HGNC:24615
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  7. Molina H, Horn DM, Tang N, Mathivanan S, Pandey A: Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry. Proc Natl Acad Sci U S A. 2007 Feb 13;104(7):2199-204. Epub 2007 Feb 7. [PubMed:17287340 ]
  8. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA: The sequence and analysis of duplication-rich human chromosome 16. Nature. 2004 Dec 23;432(7020):988-94. [PubMed:15616553 ]
  9. Brill LM, Salomon AR, Ficarro SB, Mukherji M, Stettler-Gill M, Peters EC: Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry. Anal Chem. 2004 May 15;76(10):2763-72. [PubMed:15144186 ]
  10. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  11. Ryazanov AG, Ward MD, Mendola CE, Pavur KS, Dorovkov MV, Wiedmann M, Erdjument-Bromage H, Tempst P, Parmer TG, Prostko CR, Germino FJ, Hait WN: Identification of a new class of protein kinases represented by eukaryotic elongation factor-2 kinase. Proc Natl Acad Sci U S A. 1997 May 13;94(10):4884-9. [PubMed:9144159 ]