You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07673
Secondary Accession Numbers
  • 13382
Name Extended synaptotagmin-3
Synonyms
  1. Chr3Syt
  2. E-Syt3
Gene Name ESYT3
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function May play a role as calcium-regulated intrinsic membrane protein
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cell membrane
  2. Single-pass membrane protein
Gene Properties
Chromosome Location Chromosome:3
Locus 3q22.3
SNPs ESYT3
Gene Sequence
>2661 bp
ATGCGAGCAGAGGAGCCCTGCGCCCCCGGGGCCCCCAGCGCCCTGGGAGCCCAGCGCACG
CCGGGCCCCGAGCTGCGCCTGTCCAGCCAGCTGCTGCCCGAGCTCTGTACCTTCGTGGTG
CGCGTGCTGTTCTACCTGGGGCCTGTCTACCTAGCTGGCTACCTGGGGCTCAGCATAACC
TGGTTGCTGCTCGGCGCCCTGCTGTGGATGTGGTGGCGCAGGAACCGCCGCGGGAAGCTT
GGGCGCCTGGCCGCCGCCTTCGAATTCCTTGACAATGAACGCGAGTTCATCAGCCGCGAG
CTGCGGGGCCAGCACCTGCCAGCCTGGATCCACTTCCCGGACGTGGAGCGGGTCGAGTGG
GCCAACAAGATCATCTCTCAGACCTGGCCCTACCTAAGCATGATCATGGAAAGCAAGTTC
CGGGAGAAACTTGAGCCCAAGATCCGAGAGAAGAGCATCCACCTGAGGACCTTTACCTTT
ACCAAGCTCTACTTTGGACAGAAGTGTCCCAGGGTCAACGGTGTCAAGGCACACACTAAT
ACGTGCAACCGAAGACGTGTGACTGTGGACCTGCAGATCTGCTACATCGGGGACTGTGAG
ATCAGTGTGGAGCTGCAGAAGATTCAGGCTGGTGTGAACGGGATCCAGTTGCAGGGCACC
CTGCGGGTCATCCTGGAGCCCCTCCTAGTGGACAAGCCCTTTGTGGGAGCCGTGACTGTG
TTCTTCCTTCAGAAGCCGCACCTACAGATCAACTGGACTGGCCTGACCAACCTGCTGGAT
GCGCCGGGAATCAATGATGTGTCAGACAGCTTACTGGAGGACCTCATTGCCACCCACCTG
GTGCTGCCCAACCGTGTGACTGTGCCTGTGAAGAAGGGGCTGGATCTGACCAACCTGCGC
TTCCCTCTGCCCTGTGGGGTGATCAGAGTGCACTTGCTGGAGGCAGAGCAGCTGGCCCAG
AAGGACAACTTTCTGGGGCTCCGAGGCAAGTCAGATCCCTACGCCAAGGTGAGCATCGGC
CTACAGCATTTCCGGAGTAGGACCATCTACAGGAACCTGAACCCCACCTGGAACGAAGTG
TTTGAGTTCATGGTGTACGAAGTCCCTGGACAGGACCTGGAGGTAGACCTGTATGATGAG
GATACCGACAGGGATGACTTCCTGGGCAGCCTGCAGATCTGCCTTGGAGATGTCATGACC
AACAGAGTGGTGGATGAGTGGTTTGTCCTGAATGACACAACCAGCGGGCGGCTGCACCTG
CGGCTGGAGTGGCTTTCATTGCTTACTGACCAAGAAGTTCTGACTGAGGACCATGGTGGC
CTTTCCACTGCCATTCTCGTGGTCTTCTTGGAGAGTGCCTGCAACTTGCCGAGAAACCCT
TTTGACTACCTGAATGGTGAATATCGAGCCAAAAAACTCTCCAGGTTTGCCAGAAACAAG
GTCAGCAAAGACCCTTCTTCCTATGTCAAACTATCTGTAGGCAAGAAGACACATACAAGT
AAGACCTGTCCCCACAACAAGGACCCTGTGTGGAGCCAGGTGTTCTCCTTCTTTGTGCAC
AATGTGGCCACTGAGCGGCTCCATCTGAAGGTGCTTGATGATGACCAGGAGTGTGCTCTG
GGAATGCTGGAGGTCCCCCTGTGCCAGATCCTCCCCTATGCTGACCTCACTCTTGAGCAG
CGCTTTCAGCTGGACCACTCAGGCCTGGACAGCCTCATCTCCATGAGGCTGGTGCTTCGG
TTCCTGCAAGTGGAGGAACGAGAGCTGGGGAGCCCATACACAGGACCTGAAGCCCTAAAG
AAAGGCCCTCTGCTCATCAAGAAAGTGGCTACCAACCAGGGTCCCAAAGCCCAACCTCAG
GAAGAAGGCCCTACAGATTTGCCATGTCCCCCAGACCCTGCTTCTGATACTAAGGACGTA
TCCAGGAGTACCACAACCACCACCAGTGCTACCACCGTTGCCACTGAGCCCACATCCCAA
GAGACAGGCCCAGAGCCTAAAGGCAAGGACAGTGCCAAAAGGTTCTGTGAGCCCATCGGG
GAGAAGAAGAGTCCAGCCACCATCTTCCTGACTGTCCCAGGTCCCCACTCTCCAGGGCCC
ATCAAGTCACCCAGACCCATGAAATGCCCTGCCTCCCCATTCGCATGGCCGCCCAAGAGG
CTGGCTCCCAGCATGTCCTCGCTCAACTCCTTGGCCTCTTCTTGCTTTGACCTGGCAGAT
ATCAGCCTCAACATTGAAGGTGGGGACCTCAGGCGACGGCAGCTGGGTGAGATTCAGCTC
ACAGTGCGCTATGTGTGTCTGCGGCGCTGCCTCAGCGTGCTAATCAATGGCTGCAGAAAC
CTAACACCATGTACCAGCAGTGGAGCTGATCCCTACGTCCGTGTCTACTTGTTGCCAGAA
AGGAAGTGGGCATGTCGTAAGAAGACTTCAGTGAAGCGGAAGACCTTGGAACCCCTGTTT
GATGAGACATTTGAATTTTTTGTTCCCATGGAAGAAGTAAAGAAGAGGTCACTAGATGTT
GCAGTGAAAAATAGTAGGCCACTTGGCTCACACAGAAGAAAGGAGTTAGGAAAAGTACTG
ATTGACTTATCAAAAGAAGATCTGATTAAGGGCTTTTCACAATGGTATGAGCTGACTCCA
AATGGACAGCCCAGAAGCTGA
Protein Properties
Number of Residues 886
Molecular Weight 100034.5
Theoretical pI 8.47
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 51-71
Protein Sequence
>Extended synaptotagmin-3
MRAEEPCAPGAPSALGAQRTPGPELRLSSQLLPELCTFVVRVLFYLGPVYLAGYLGLSIT
WLLLGALLWMWWRRNRRGKLGRLAAAFEFLDNEREFISRELRGQHLPAWIHFPDVERVEW
ANKIISQTWPYLSMIMESKFREKLEPKIREKSIHLRTFTFTKLYFGQKCPRVNGVKAHTN
TCNRRRVTVDLQICYIGDCEISVELQKIQAGVNGIQLQGTLRVILEPLLVDKPFVGAVTV
FFLQKPHLQINWTGLTNLLDAPGINDVSDSLLEDLIATHLVLPNRVTVPVKKGLDLTNLR
FPLPCGVIRVHLLEAEQLAQKDNFLGLRGKSDPYAKVSIGLQHFRSRTIYRNLNPTWNEV
FEFMVYEVPGQDLEVDLYDEDTDRDDFLGSLQICLGDVMTNRVVDEWFVLNDTTSGRLHL
RLEWLSLLTDQEVLTEDHGGLSTAILVVFLESACNLPRNPFDYLNGEYRAKKLSRFARNK
VSKDPSSYVKLSVGKKTHTSKTCPHNKDPVWSQVFSFFVHNVATERLHLKVLDDDQECAL
GMLEVPLCQILPYADLTLEQRFQLDHSGLDSLISMRLVLRFLQVEERELGSPYTGPEALK
KGPLLIKKVATNQGPKAQPQEEGPTDLPCPPDPASDTKDVSRSTTTTTSATTVATEPTSQ
ETGPEPKGKDSAKRFCEPIGEKKSPATIFLTVPGPHSPGPIKSPRPMKCPASPFAWPPKR
LAPSMSSLNSLASSCFDLADISLNIEGGDLRRRQLGEIQLTVRYVCLRRCLSVLINGCRN
LTPCTSSGADPYVRVYLLPERKWACRKKTSVKRKTLEPLFDETFEFFVPMEEVKKRSLDV
AVKNSRPLGSHRRKELGKVLIDLSKEDLIKGFSQWYELTPNGQPRS
GenBank ID Protein 103472031
UniProtKB/Swiss-Prot ID A0FGR9
UniProtKB/Swiss-Prot Entry Name ESYT3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_031913.3
GeneCard ID ESYT3
GenAtlas ID ESYT3
HGNC ID HGNC:24295
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Min SW, Chang WP, Sudhof TC: E-Syts, a family of membranous Ca2+-sensor proteins with multiple C2 domains. Proc Natl Acad Sci U S A. 2007 Mar 6;104(10):3823-8. Epub 2007 Feb 28. [PubMed:17360437 ]
  4. Craxton M: Genomic analysis of synaptotagmin genes. Genomics. 2001 Sep;77(1-2):43-9. [PubMed:11543631 ]