You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07681
Secondary Accession Numbers
  • 13390
Name Fibrillin-3
Synonyms Not Available
Gene Name FBN3
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Fibrillins are structural components of 10-12 nm extracellular calcium-binding microfibrils, which occur either in association with elastin or in elastin-free bundles. Fibrillin- containing microfibrils provide long-term force bearing structural support
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region part
extracellular matrix
proteinaceous extracellular matrix
Function
ion binding
cation binding
metal ion binding
binding
structural molecule activity
extracellular matrix structural constituent
calcium ion binding
Cellular Location
  1. Secreted
  2. extracellular space
  3. extracellular matrix
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13
SNPs FBN3
Gene Sequence
>8430 bp
ATGACTCTGGAGGGTCTGTATTTGGCAAGGGGCCCCCTGGCCCGGCTCCTGCTGGCCTGG
TCGGCCCTGTTGTGCATGGCAGGTGGCCAAGGCCGCTGGGACGGGGCCTTGGAGGCTGCA
GGTCCTGGACGTGTGCGGAGGCGGGGCAGCCCAGGCATCTTGCAGGGGCCGAATGTGTGC
GGCTCCCGGTTCCATGCCTACTGCTGTCCAGGCTGGAGGACATTCCCTGGCAGGAGCCAG
TGTGTCGTACCCATCTGTAGGCGCGCCTGCGGTGAAGGCTTCTGCTCCCAGCCCAACCTG
TGCACCTGTGCGGATGGGACGCTGGCTCCCAGCTGCGGGGTGAGCCGAGGGTCAGGGTGC
AGTGTGAGCTGTATGAATGGGGGCACCTGCCGGGGGGCGTCCTGTCTGTGTCAGAAGGGC
TACACAGGCACCGTGTGTGGGCAGCCCATCTGTGACCGCGGCTGCCACAATGGGGGTCGC
TGCATTGGGCCCAACCGCTGCGCCTGTGTGTATGGCTTCATGGGACCTCAATGTGAGAGA
GATTACCGGACGGGACCCTGCTTTGGCCAAGTAGGCCCCGAGGGGTGCCAGCATCAGCTG
ACGGGCCTCGTGTGCACCAAGGCACTTTGCTGTGCCACTGTGGGCCGTGCCTGGGGCCTT
CCATGTGAACTTTGCCCTGCACAGCCACACCCCTGCCGCCGCGGCTTCATCCCCAATATC
CACACGGGGGCCTGCCAAGATGTGGATGAGTGCCAGGCTGTGCCAGGCCTGTGCCAGGGA
GGCAGCTGCGTCAACATGGTGGGCTCCTTCCATTGCCGCTGTCCAGTTGGACACCGGCTC
AGTGACAGCAGCGCCGCATGTGAAGACTACCGGGCCGGCGCCTGCTTCTCAGTGCTTTTC
GGGGGCCGCTGTGCTGGAGACCTCGCCGGCCACTACACTCGCAGGCAGTGCTGCTGTGAC
AGGGGCAGGTGCTGGGCAGCTGGCCCGGTCCCTGAGCTGTGTCCTCCTCGGGGCTCCAAT
GAATTCCAGCAACTGTGCGCCCAGCGGCTGCCGCTGCTACCCGGCCACCCTGGCCTCTTC
CCTGGCCTCCTGGGCTTCGGATCCAATGGCATGGGTCCCCCTCTTGGGCCAGCGCGACTC
AACCCCCATGGCTCTGATGCGCGTGGGATCCCCAGCCTGGGCCCTGGCAACTCTAATATT
GGCACTGCTACCCTGAACCAGACCATTGACATCTGCCGACACTTCACCAACCTGTGTCTG
AATGGCCGCTGCCTGCCCACGCCTTCCAGCTACCGCTGCGAGTGTAACGTGGGCTACACC
CAGGACGTGCGCGGCGAGTGCATTGATGTAGACGAATGCACCAGCAGCCCCTGCCACCAC
GGTGACTGCGTCAACATCCCCGGCACCTACCACTGCCGGTGCTACCCGGGCTTCCAGGCC
ACGCCCACCAGGCAGGCATGCGTGGATGTGGACGAGTGCATTGTCAGTGGTGGCCTTTGT
CACCTGGGCCGCTGTGTCAACACAGAGGGCAGCTTCCAGTGTGTCTGCAATGCAGGCTTC
GAGCTCAGCCCTGACGGCAAGAACTGTGTGGACCACAACGAGTGTGCCACCAGCACCATG
TGCGTCAACGGCGTGTGTCTCAACGAGGATGGCAGCTTCTCCTGCCTCTGCAAACCCGGC
TTCCTGCTGGCGCCTGGCGGCCACTACTGCATGGACATTGACGAGTGCCAGACGCCCGGC
ATCTGCGTGAACGGCCACTGTACCAACACCGAGGGCTCCTTCCGCTGCCAGTGCCTGGGG
GGGCTGGCGGTAGGCACGGATGGCCGCGTGTGCGTGGACACCCACGTGCGCAGCACCTGC
TATGGGGCCATCGAGAAGGGCTCCTGTGCCCGCCCCTTCCCTGGCACTGTCACCAAGTCC
GAGTGCTGCTGTGCCAATCCGGACCACGGTTTTGGGGAGCCCTGCCAGCTTTGTCCTGCC
AAAGACTCCGCTGAGTTCCAGGCACTGTGCAGCAGTGGGCTTGGCATTACCACGGATGGT
CGAGACATCAACGAGTGTGCTCTGGATCCTGAGGTTTGTGCCAATGGCGTGTGCGAGAAC
CTTCGGGGCAGCTACCGCTGTGTCTGCAACCTGGGTTATGAGGCAGGTGCCTCAGGCAAG
GACTGCACAGACGTGGATGAGTGTGCCCTCAACAGCCTCCTGTGTGACAACGGGTGGTGC
CAGAATAGCCCTGGCAGCTACAGCTGCTCCTGCCCCCCCGGCTTCCACTTCTGGCAGGAC
ACGGAGATCTGCAAAGATGTCGACGAATGCCTGTCCAGCCCGTGTGTGAGTGGCGTCTGT
CGGAACCTGGCCGGCTCCTACACCTGCAAATGTGGCCCTGGCAGCCGGCTGGACCCCTCT
GGTACCTTCTGTCTAGACAGCACCAAGGGCACCTGCTGGCTGAAGATCCAGGAGAGCCGC
TGTGAGGTGAACCTTCAGGGAGCCAGCCTGCGGTCTGAGTGCTGCGCCACCCTCGGGGCA
GCCTGGGGGAGCCCCTGCGAACGCTGCGAGATCGACCCTGCCTGTGCCCGGGGCTTTGCC
CGGATGACGGGTGTCACCTGCGATGATGTGAACGAGTGTGAGTCCTTCCCGGGAGTCTGT
CCCAACGGGCGTTGCGTCAACACTGCTGGGTCTTTCCGCTGTGAGTGTCCAGAGGGCCTG
ATGCTGGACGCCTCAGGCCGGCTGTGCGTGGATGTGAGATTGGAACCATGTTTCCTGCGA
TGGGATGAGGATGAGTGTGGGGTCACCCTGCCTGGCAAGTACCGGATGGACGTCTGCTGC
TGCTCCATCGGGGCCGTGTGGGGAGTCGAGTGCGAGGCCTGCCCGGATCCCGAGTCTCTG
GAGTTCGCCAGCCTGTGCCCGCGGGGGCTGGGCTTCGCCAGCCGGGACTTCCTGTCTGGC
CGACCATTCTATAAAGATGTGAATGAATGCAAGGTGTTCCCTGGCCTCTGCACGCACGGT
ACCTGCAGAAACACGGTGGGCAGCTTCCACTGCGCCTGTGCGGGGGGCTTCGCCCTGGAT
GCCCAGGAACGGAACTGCACAGATATCGACGAGTGTCGCATCTCTCCTGACCTCTGCGGC
CAGGGCACCTGTGTCAACACGCCGGGCAGCTTTGAGTGCGAGTGTTTTCCCGGCTACGAG
AGTGGCTTCATGCTGATGAAGAACTGCATGGACGTGGACGAGTGTGCAAGGGACCCGCTG
CTCTGCCGGGGAGGCACTTGCACCAACACGGATGGGAGCTACAAGTGCCAGTGTCCCCCT
GGGCATGAGCTGACGGCCAAGGGCACTGCCTGTGAGGACATCGATGAGTGCTCCCTGAGT
GATGGCCTGTGTCCCCATGGCCAGTGTGTCAATGTCATCGGTGCCTTCCAGTGCTCCTGC
CATGCCGGCTTCCAGAGCACACCTGACCGCCAGGGCTGCGTGGACATCAACGAATGCCGG
GTCCAGAATGGTGGGTGTGACGTGCACTGTATTAACACTGAGGGCAGCTACCGGTGCAGC
TGTGGGCAGGGCTACTCGCTGATGCCCGACGGAAGGGCATGTGCAGACGTGGACGAGTGT
GAAGAGAACCCCCGCGTTTGTGACCAAGGCCACTGCACCAACATGCCAGGGGGTCACCGC
TGCCTGTGCTATGATGGCTTCATGGCCACGCCAGACATGAGGACATGTGTTGATGTGGAT
GAGTGTGACCTGAACCCTCACATCTGCCTCCATGGGGACTGCGAGAACACGAAGGGTTCC
TTTGTCTGCCACTGTCAGCTGGGCTACATGGTCAGGAAGGGGGCCACAGGCTGCTCTGAT
GTGGATGAATGCGAGGTTGGAGGACACAACTGTGACAGTCACGCCTCCTGTCTCAACATC
CCGGGGAGTTTCAGCTGTAGGTGCCTGCCAGGCTGGGTGGGGGATGGCTTCGAATGTCAC
GACCTGGATGAATGCGTCTCCCAGGAGCACCGGTGCAGCCCAAGAGGTGACTGTCTCAAT
GTCCCTGGCTCCTACCGCTGCACCTGCCGCCAGGGCTTTGCCGGGGATGGCTTCTTCTGC
GAAGACAGGGATGAATGTGCCGAGAACGTGGACCTCTGTGACAACGGGCAGTGCCTCAAT
GCGCCCGGCGGGTACCGCTGTGAATGTGAGATGGGCTTTGACCCCACCGAGGACCACCGG
GCCTGCCAGGATGTGGACGAGTGTGCGCAAGGGAACCTCTGTGCATTTGGGAGCTGTGAG
AACCTGCCTGGAATGTTCCGCTGCATCTGCAATGGTGGCTACGAACTGGACCGAGGGGGT
GGCAACTGCACAGACATCAACGAGTGTGCAGACCCAGTAAACTGCATCAACGGCGTGTGC
ATTAACACCCCCGGCAGCTACCTCTGCAGCTGCCCCCAGGATTTTGAGCTGAACCCCAGC
GGAGTGGGCTGCGTGGACACTCGGGCCGGGAACTGTTTCCTGGAGACGCATGACCGAGGG
GACAGTGGCATTTCCTGCAGTGCCGAGATCGGAGTTGGTGTCACCCGAGCTTCCTGCTGT
TGCTCCCTGGGCCGGGCTTGGGGCAATCCCTGTGAGCTGTGCCCTATGGCCAACACCACT
GAGTACAGAACCCTGTGCCCGGGTGGTGAGGGCTTCCAGCCTAACCGCATCACTGTCATT
CTGGAAGACATCGACGAGTGCCAAGAGCTGCCAGGGCTGTGTCAGGGGGGTGACTGCGTC
AACACGTTTGGCAGTTTCCAGTGTGAGTGCCCACCTGGCTACCACCTCAGTGAGCACACC
CGCATCTGTGAGGATATTGACGAATGCTCCACACACTCCGGCATCTGTGGCCCTGGCACC
TGCTACAACACCCTGGGGAACTACACCTGTGTCTGCCCTGCAGAGTACCTCCAAGTCAAT
GGTGGCAACAACTGCATGGATATGAGGAAGAGTGTCTGCTTCCGGCACTATAACGGCACA
TGTCAAAATGAGCTGGCCTTCAACGTGACCCGGAAAATGTGTTGCTGCTCCTACAACATT
GGCCAGGCCTGGAATAGACCCTGTGAGGCCTGCCCCACTCCCATCAGTCCTGACTACCAG
ATCCTGTGTGGAAATCAGGCCCCGGGATTCCTCACTGACATCCACACGGGGAAGCCCCTT
GACATTGATGAGTGTGGGGAGATCCCCGCCATCTGTGCCAATGGCATCTGCATAAACCAG
ATCGGGAGTTTCCGCTGCGAGTGCCCCGCAGGCTTCAACTACAACAGCATCCTGCTGGCT
TGTGAAGATGTCGATGAGTGTGGCAGCAGGGAGAGTCCCTGCCAGCAGAATGCTGACTGC
ATCAACATCCCCGGTAGCTACCGCTGCAAGTGCACCCGAGGGTACAAACTGTCGCCAGGC
GGGGCTTGTGTGGGACGGAATGAGTGTCGGGAGATCCCGAATGTCTGTAGCCATGGTGAC
TGCATGGACACAGAAGGCAGCTACATGTGTCTGTGTCACCGTGGATTCCAGGCCTCTGCA
GACCAGACCCTGTGCATGGACATTGACGAGTGTGACCGGCAGCCTTGTGGAAATGGGACC
TGCAAGAACATCATTGGCTCCTACAACTGCCTCTGCTTCCCTGGCTTTGTGGTGACACAC
AATGGGGATTGTGTGGATTTTGATGAGTGTACTACCCTGGTGGGGCAGGTGTGCCGATTT
GGCCATTGCCTCAACACAGCTGGTTCCTTCCACTGCCTCTGCCAGGATGGCTTTGAGCTC
ACAGCTGATGGGAAGAACTGTGTGGACACCAATGAGTGCCTCAGCCTTGCAGGAACCTGC
CTACCCGGCACTTGCCAGAACCTCGAGGGCTCCTTCCGCTGCATCTGTCCCCCTGGCTTC
CAGGTGCAGAGTGACCACTGCATTGATATCGACGAGTGCTCAGAGGAGCCCAACCTCTGC
CTCTTTGGCACCTGTACCAACAGCCCTGGGAGCTTCCAGTGCCTCTGCCCACCTGGCTTT
GTCCTCTCTGACAATGGGCACCGTTGCTTTGACACACGGCAGAGTTTCTGCTTCACCCGT
TTTGAGGCTGGGAAGTGCTCGGTGCCCAAAGCTTTCAACACCACCAAGACCCGCTGCTGC
TGCAGTAAGAGGCCTGGGGAGGGCTGGGGAGACCCCTGCGAACTGTGTCCCCAGGAGGGC
AGCGCTGCCTTTCAGGAGCTCTGCCCCTTTGGCCACGGGGCAGTCCCAGGCCCGGATGAC
TCCCGAGAAGACGTGAATGAGTGTGCAGAGAACCCTGGCGTCTGCACTAACGGCGTCTGT
GTCAACACCGATGGATCCTTCCGCTGTGAGTGTCCCTTTGGCTACAGCCTGGACTTCACT
GGCATCAACTGTGTGGACACAGACGAGTGCTCTGTCGGCCACCCCTGTGGGCAAGGGACA
TGCACCAATGTCATCGGAGGCTTCGAATGTGCCTGTGCTGACGGCTTTGAGCCTGGCCTC
ATGATGACCTGCGAGGACATCGACGAATGCTCCCTGAACCCGCTGCTCTGTGCCTTCCGC
TGCCACAATACCGAGGGCTCCTACCTGTGCACCTGTCCAGCCGGCTACACCCTGCGGGAG
GATGGGGCCATGTGTCGAGATGTGGACGAGTGTGCAGATGGTCAGCAGGACTGCCACGCC
CGGGGCATGGAGTGCAAGAACCTCATCGGTACCTTCGCGTGCGTCTGTCCCCCAGGCATG
CGGCCCCTGCCTGGCTCTGGGGAGGGCTGCACAGATGACAATGAATGCCACGCTCAGCCT
GACCTCTGTGTCAACGGCCGCTGTGTCAACACCGCGGGCAGCTTCCGGTGCGACTGTGAT
GAGGGATTCCAGCCCAGCCCCACCCTTACCGAGTGCCACGACATCCGGCAGGGGCCCTGC
TTTGCCGAGGTGCTGCAGACCATGTGCCGGTCTCTGTCCAGCAGCAGTGAGGCTGTCACC
AGGGCCGAGTGCTGCTGTGGGGGTGGCCGGGGCTGGGGGCCCCGCTGCGAGCTCTGTCCC
CTGCCCGGCACCTCTGCCTACAGGAAGCTGTGCCCCCATGGCTCAGGCTACACTGCTGAG
GGCCGAGATGTAGATGAATGCCGTATGCTTGCTCACCTGTGTGCTCATGGGGAGTGCATC
AACAGCCTTGGCTCCTTCCGCTGCCACTGTCAGGCCGGGTACACACCGGATGCTACTGCT
ACTACCTGCCTGGATATGGATGAGTGCAGCCAGGTCCCCAAGCCATGTACCTTCCTCTGC
AAAAACACGAAGGGCAGTTTCCTGTGCAGCTGTCCCCGAGGCTACCTGCTGGAGGAGGAT
GGCAGGACCTGCAAAGACCTGGACGAATGCACCTCCCGGCAGCACAACTGTCAGTTCCTC
TGTGTCAACACTGTGGGCGCCTTCACCTGCCGCTGTCCGCCCGGCTTCACCCAGCACCAC
CAGGCCTGCTTCGACAATGATGAGTGCTCAGCCCAGCCTGGCCCATGTGGTGCCCACGGG
CACTGCCACAACACCCCGGGCAGCTTCCGCTGTGAATGCCACCAAGGCTTCACCCTGGTC
AGCTCAGGCCATGGCTGTGAAGATGTGAATGAATGTGATGGGCCCCACCGCTGCCAGCAT
GGCTGTCAGAACCAGCTAGGGGGCTACCGCTGCAGCTGCCCCCAGGGTTTCACCCAGCAC
TCCCAGTGGGCCCAGTGTGTGGATGAGAATGAGTGTGCCCTGTCGCCCCCCACCTGCGGG
AGCGCCTCCTGTCGCAACACTCTTGGTGGCTTCCGCTGCGTCTGCCCCTCTGGCTTTGAC
TTTGATCAGGCCCTCGGGGGCTGCCAGGAGGTGGATGAGTGCGCCGGACGGCGTGGCCCC
TGTAGCTACAGCTGTGCCAACACGCCTGGTGGCTTCCTGTGCGGCTGTCCTCAAGGCTAC
TTCCGGGCTGGGCAAGGGCACTGTGTCTCCGGCCTGGGCTTCAGCCCCGGACCCCAGGAC
ACCCCGGACAAAGAGGAGCTGCTCTCGTCTGAAGCCTGCTACGAATGCAAGATCAATGGC
CTCTCCCCTCGGGACCGGCCACGACGCAGTGCCCACAGGGACCACCAGGTGAACCTGGCC
ACCCTTGACTCCGAGGCCCTGCTGACCTTGGGCCTGAACCTCTCACACCTGGGCCGGGCC
GAGCGCATCCTGGAGCTCCGGCCGGCCCTGGAGGGTCTAGAGGGCCGGATCCGCTACGTC
ATCGTCCGCGGAAACGAGCAAGGTTTCTTTCGCATGCATCACCTCCGTGGCGTCAGCTCC
CTGCAGCTGGGGCGGAGGCGGCCGGGGCCTGGAACCTACCGGCTGGAGGTGGTGAGCCAC
ATGGCAGGACCCTGGGGTGTCCAGCCAGAGGGGCAGCCAGGGCCATGGGGCCAGGCCTTG
AGGCTGAAGGTGCAGCTGCAGTTGCTTTAG
Protein Properties
Number of Residues 2809
Molecular Weight 300352.9
Theoretical pI 4.69
Pfam Domain Function
Signals
  • 1-31
Transmembrane Regions
  • None
Protein Sequence
>Fibrillin-3
MTLEGLYLARGPLARLLLAWSALLCMAGGQGRWDGALEAAGPGRVRRRGSPGILQGPNVC
GSRFHAYCCPGWRTFPGRSQCVVPICRRACGEGFCSQPNLCTCADGTLAPSCGVSRGSGC
SVSCMNGGTCRGASCLCQKGYTGTVCGQPICDRGCHNGGRCIGPNRCACVYGFMGPQCER
DYRTGPCFGQVGPEGCQHQLTGLVCTKALCCATVGRAWGLPCELCPAQPHPCRRGFIPNI
HTGACQDVDECQAVPGLCQGGSCVNMVGSFHCRCPVGHRLSDSSAACEDYRAGACFSVLF
GGRCAGDLAGHYTRRQCCCDRGRCWAAGPVPELCPPRGSNEFQQLCAQRLPLLPGHPGLF
PGLLGFGSNGMGPPLGPARLNPHGSDARGIPSLGPGNSNIGTATLNQTIDICRHFTNLCL
NGRCLPTPSSYRCECNVGYTQDVRGECIDVDECTSSPCHHGDCVNIPGTYHCRCYPGFQA
TPTRQACVDVDECIVSGGLCHLGRCVNTEGSFQCVCNAGFELSPDGKNCVDHNECATSTM
CVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQTPGICVNGHCTNTEGSFRCQCLG
GLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPA
KDSAEFQALCSSGLGITTDGRDINECALDPEVCANGVCENLRGSYRCVCNLGYEAGASGK
DCTDVDECALNSLLCDNGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDECLSSPCVSGVC
RNLAGSYTCKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGA
AWGSPCERCEIDPACARGFARMTGVTCDDVNECESFPGVCPNGRCVNTAGSFRCECPEGL
MLDASGRLCVDVRLEPCFLRWDEDECGVTLPGKYRMDVCCCSIGAVWGVECEACPDPESL
EFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFALD
AQERNCTDIDECRISPDLCGQGTCVNTPGSFECECFPGYESGFMLMKNCMDVDECARDPL
LCRGGTCTNTDGSYKCQCPPGHELTAKGTACEDIDECSLSDGLCPHGQCVNVIGAFQCSC
HAGFQSTPDRQGCVDINECRVQNGGCDVHCINTEGSYRCSCGQGYSLMPDGRACADVDEC
EENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDLNPHICLHGDCENTKGS
FVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDGFECH
DLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDLCDNGQCLN
APGGYRCECEMGFDPTEDHRACQDVDECAQGNLCAFGSCENLPGMFRCICNGGYELDRGG
GNCTDINECADPVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRG
DSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVI
LEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDECSTHSGICGPGT
CYNTLGNYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYNGTCQNELAFNVTRKMCCCSYNI
GQAWNRPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDECGEIPAICANGICINQ
IGSFRCECPAGFNYNSILLACEDVDECGSRESPCQQNADCINIPGSYRCKCTRGYKLSPG
GACVGRNECREIPNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECDRQPCGNGT
CKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVGQVCRFGHCLNTAGSFHCLCQDGFEL
TADGKNCVDTNECLSLAGTCLPGTCQNLEGSFRCICPPGFQVQSDHCIDIDECSEEPNLC
LFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCC
CSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPGPDDSREDVNECAENPGVCTNGVC
VNTDGSFRCECPFGYSLDFTGINCVDTDECSVGHPCGQGTCTNVIGGFECACADGFEPGL
MMTCEDIDECSLNPLLCAFRCHNTEGSYLCTCPAGYTLREDGAMCRDVDECADGQQDCHA
RGMECKNLIGTFACVCPPGMRPLPGSGEGCTDDNECHAQPDLCVNGRCVNTAGSFRCDCD
EGFQPSPTLTECHDIRQGPCFAEVLQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCP
LPGTSAYRKLCPHGSGYTAEGRDVDECRMLAHLCAHGECINSLGSFRCHCQAGYTPDATA
TTCLDMDECSQVPKPCTFLCKNTKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNCQFL
CVNTVGAFTCRCPPGFTQHHQACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLV
SSGHGCEDVNECDGPHRCQHGCQNQLGGYRCSCPQGFTQHSQWAQCVDENECALSPPTCG
SASCRNTLGGFRCVCPSGFDFDQALGGCQEVDECAGRRGPCSYSCANTPGGFLCGCPQGY
FRAGQGHCVSGLGFSPGPQDTPDKEELLSSEACYECKINGLSPRDRPRRSAHRDHQVNLA
TLDSEALLTLGLNLSHLGRAERILELRPALEGLEGRIRYVIVRGNEQGFFRMHHLRGVSS
LQLGRRRPGPGTYRLEVVSHMAGPWGVQPEGQPGPWGQALRLKVQLQLL
GenBank ID Protein 56237021
UniProtKB/Swiss-Prot ID Q75N90
UniProtKB/Swiss-Prot Entry Name FBN3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_032447.3
GeneCard ID FBN3
GenAtlas ID FBN3
HGNC ID HGNC:18794
References
General References
  1. Nagase T, Nakayama M, Nakajima D, Kikuno R, Ohara O: Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2001 Apr 27;8(2):85-95. [PubMed:11347906 ]
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  3. Uyeda T, Takahashi T, Eto S, Sato T, Xu G, Kanezaki R, Toki T, Yonesaka S, Ito E: Three novel mutations of the fibrillin-1 gene and ten single nucleotide polymorphisms of the fibrillin-3 gene in Marfan syndrome patients. J Hum Genet. 2004;49(8):404-7. Epub 2004 Jun 23. [PubMed:15221638 ]
  4. Corson GM, Charbonneau NL, Keene DR, Sakai LY: Differential expression of fibrillin-3 adds to microfibril variety in human and avian, but not rodent, connective tissues. Genomics. 2004 Mar;83(3):461-72. [PubMed:14962672 ]