You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07708
Secondary Accession Numbers
  • 13417
Name GC-rich sequence DNA-binding factor
Synonyms
  1. GCF
  2. TCF-9
  3. Transcription factor 9
Gene Name TCF9
Protein Type Unknown
Biological Properties
General Function Involved in DNA binding
Specific Function Factor that represses transcription. It binds to the GC- rich sequences (5'-GCGGGGC-3') present in the epidermal growth factor receptor, beta-actin, and calcium-dependent protease promoters
Pathways Not Available
Reactions Not Available
GO Classification
Component
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
Function
binding
nucleic acid binding
dna binding
sequence-specific dna binding transcription factor activity
Process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs TCF9
Gene Sequence
>2346 bp
ATGGCTCACAGGCCGAAAAGGACTTTTCGGCAGCGCGCGGCTGATTCCAGCGACAGCGAT
GGCGCCGAGGAGTCGCCTGCTGAGCCTGGGGCGCCGAGGGAACTTCCGGTCCCGGGTTCT
GCGGAGGAAGAGCCGCCCTCTGGAGGAGGCCGCGCGCAGGTGGCGGGACTGCCCCACCGG
GTTCGGGGCCCTCGTGGCCGGGGCCGGGTCTGGGCGAGCTCCCGGCGTGCCACCAAAGCG
GCTCCCCGCGCGGACGAAGGCTCAGAATCCAGAACCCTTGATGTGTCCACAGATGAAGAG
GATAAAATACATCACTCCTCAGAAAGTAAGGATGATCAGGGTTTGTCTTCTGACAGTTCT
AGCTCTCTTGGAGAAAAAGAACTTTCATCAACAGTTAAGATCCCAGATGCAGCTTTTATT
CAGGCAGCCCGCAGAAAACGTGAATTGGCCAGGGCCCAAGATGACTATATTTCTTTGGAT
GTACAACATACCTCCTCCATCTCTGGTATGAAGAGAGAGAGCGAAGATGACCCTGAGAGT
GAGCCTGATGACCATGAAAAGAGAATACCATTTACTCTAAGACCTCAAACACTTAGACAA
AGGATGGCTGAGGAATCAATAAGCAGAAATGAAGAAACAAGTGAAGAAAGTCAGGAAGAT
GAAAAGCAAGATACTTGGGAACAACAGCAAATGAGGAAAGCAGTTAAAATCATAGAGGAA
AGAGACATAGATCTTTCCTGTGGCAATGGATCTTCAAAAGTGAAGAAATTTGATACTTCC
ATTTCATTTCCGCCAGTAAATTTAGAAATTATAAAGAAGCAATTAAATACTAGATTAACA
TTACTACAGGAAACTCACCGCTCACACCTGAGGGAGTATGAAAAATACGTACAAGATGTC
AAAAGCTCAAAGAGTACCATCCAGAACCTAGAGAGTTCATCAAATCAAGCTCTAAATTGT
AAATTCTATAAAAGCATGAAAATTTATGTGGAAAATTTAATTGACTGCCTTAATGAAAAG
ATTATCAACATCCAAGAAATAGAATCATCCATGCATGCACTCCTTTTAAAACAAGCTATG
ACCTTTATGAAACGCAGGCAAGATGAATTAAAACATGAATCAACGTATTTACAACAGTTA
TCACGCAAAGATGAGACATCCACAAGTGGAAACTTCTCAGTAGATGAAAAAACTCAGTGG
ATTTTAGAAGAGATTGAATCTCGAAGGACAAAAAGAAGACAAGCAAGGGTGCTTTCTGGG
AATTGTAACCATCAGGAAGGAACATCTAGTGATGATGAACTGCCTTCAGCAGAGATGATT
GACTTCCAAAAAAGCCAAGGTGACATTTTACAGAAACAGAAGAAAGTTTTTGAAGAAGTG
CAAGATGATTTTTGTAACATCCAGAATATTTTGTTGAAATTTCAGCAATGGCGAGAAAAG
TTTCCTGACTCCTATTATGAAGCTTTCATTAGTTTATGCATACCAAAGCTTTTAAATCCC
CTAATACGAGTTCAGTTGATTGATTGGAATCCTCTTAAGTTGGAATCCACAGGTTTAAAA
GAGATGCCATGGTTCAAATCTGTAGAAGAATTTATGGATAGCAGTGTGGAAGATTCAAAG
AAGGAAAGTAGTTCAGATAAAAAAGTCTTGTCTGCAATCATCAACAAAACAATTATTCCC
CGACTTACAGACTTTGTAGAATTCCTTTGGGATCCTTTGTCAACCTCACAGACAACAAGT
TTAATAACACATTGCAGAGTGATTCTTGAAGAACATTCCACTTGTGAAAATGAAGTTAGT
AAAAGCAGACAGGATTTACTTAAATCCATTGTTTCAAGAATGAAAAAGGCAGTAGAAGAT
GATGTTTTTATTCCTCTGTATCCAAAGAGTGCTGTAGAAAACAAAACATCACCTCATTCA
AAGTTCCAAGAAAGACAGTTCTGGTCAGGCCTAAAGCTCTTCCGCAATATTCTTCTTTGG
AATGGACTCCTTACAGATGACACCTTGCAAGAACTAGGACTAGGGAAGCTGCTAAATCGT
TACCTTATTATAGCACTTCTCAATGCCACACCTGGGCCAGATGTGGTTAAAAAGTGCAAC
CAGGTAGCAGCATGTCTACCAGAAAAATGGTTTGAAAATTCTGCCATGAGGACATCTATT
CCACAGCTAGAAAACTTCATTCAGTTTTTATTGCAGTCTGCACATAAATTATCTAGAAGT
GAATTCAGGGATGAAGTCGAAGAAATAATTCTTATTTTGGTGAAAATAAAAGCTTTGAAT
CAAGCAGAATCCTTCATAGGAGAGCATCACCTAGACCATCTTAAATCACTAATTAAAGAA
GATTGA
Protein Properties
Number of Residues 781
Molecular Weight 89383.7
Theoretical pI 5.81
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>GC-rich sequence DNA-binding factor
MAHRPKRTFRQRAADSSDSDGAEESPAEPGAPRELPVPGSAEEEPPSGGGRAQVAGLPHR
VRGPRGRGRVWASSRRATKAAPRADEGSESRTLDVSTDEEDKIHHSSESKDDQGLSSDSS
SSLGEKELSSTVKIPDAAFIQAARRKRELARAQDDYISLDVQHTSSISGMKRESEDDPES
EPDDHEKRIPFTLRPQTLRQRMAEESISRNEETSEESQEDEKQDTWEQQQMRKAVKIIEE
RDIDLSCGNGSSKVKKFDTSISFPPVNLEIIKKQLNTRLTLLQETHRSHLREYEKYVQDV
KSSKSTIQNLESSSNQALNCKFYKSMKIYVENLIDCLNEKIINIQEIESSMHALLLKQAM
TFMKRRQDELKHESTYLQQLSRKDETSTSGNFSVDEKTQWILEEIESRRTKRRQARVLSG
NCNHQEGTSSDDELPSAEMIDFQKSQGDILQKQKKVFEEVQDDFCNIQNILLKFQQWREK
FPDSYYEAFISLCIPKLLNPLIRVQLIDWNPLKLESTGLKEMPWFKSVEEFMDSSVEDSK
KESSSDKKVLSAIINKTIIPRLTDFVEFLWDPLSTSQTTSLITHCRVILEEHSTCENEVS
KSRQDLLKSIVSRMKKAVEDDVFIPLYPKSAVENKTSPHSKFQERQFWSGLKLFRNILLW
NGLLTDDTLQELGLGKLLNRYLIIALLNATPGPDVVKKCNQVAACLPEKWFENSAMRTSI
PQLENFIQFLLQSAHKLSRSEFRDEVEEIILILVKIKALNQAESFIGEHHLDHLKSLIKE
D
GenBank ID Protein 62822425
UniProtKB/Swiss-Prot ID P16383
UniProtKB/Swiss-Prot Entry Name GCF_HUMAN
PDB IDs Not Available
GenBank Gene ID AC005034
GeneCard ID TCF9
GenAtlas ID TCF9
HGNC ID HGNC:1317
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  7. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  8. Kageyama R, Pastan I: Molecular cloning and characterization of a human DNA binding factor that represses transcription. Cell. 1989 Dec 1;59(5):815-25. [PubMed:2556218 ]