Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07721
Secondary Accession Numbers
  • 13430
Name Gastrin-releasing peptide receptor
Synonyms
  1. GRP-R
  2. GRP-preferring bombesin receptor
Gene Name GRPR
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Receptor for gastrin releasing peptide (GRP). This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
neuropeptide receptor activity
bombesin receptor activity
receptor activity
molecular transducer activity
signal transducer activity
peptide receptor activity
peptide receptor activity, g-protein coupled
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs GRPR
Gene Sequence
>1155 bp
ATGGCTCTAAATGACTGTTTCCTTCTGAACTTGGAGGTGGACCATTTCATGCACTGCAAC
ATCTCCAGTCACAGTGCGGATCTCCCCGTGAACGATGACTGGTCCCACCCGGGGATCCTC
TATGTCATCCCTGCAGTTTATGGGGTTATCATTCTGATAGGCCTCATTGGCAACATCACT
TTGATCAAGATCTTCTGTACAGTCAAGTCCATGCGAAACGTTCCAAACCTGTTCATTTCC
AGTCTGGCTTTGGGAGACCTGCTCCTCCTAATAACGTGTGCTCCAGTGGATGCCAGCAGG
TACCTGGCTGACAGATGGCTATTTGGCAGGATTGGCTGCAAACTGATCCCCTTTATACAG
CTTACCTCTGTTGGGGTGTCTGTCTTCACACTCACAGCGCTCTCGGCAGACAGATACAAA
GCCATTGTCCGGCCAATGGATATCCAGGCCTCTCATGCCCTGATGAAGATCTGCCTCAAA
GCCGCCTTTATCTGGATCATCTCCATGCTGCTGGCCATTCCAGAGGCCGTGTTTTCTGAC
CTCCATCCCTTCCATGAGGAAAGCACCAACCAGACCTTCATTAGCTGTGCCCCATACCCA
CACTCTAATGAGCTTCACCCCAAAATCCATTCTATGGCTTCCTTTCTGGTCTTCTACGTC
ATTCCACTGTCGATCATCTCTGTTTACTACTACTTCATTGCTAAAAATCTGATCCAGAGT
GCTTACAATCTTCCCGTGGAAGGGAATATACATGTCAAGAAGCAGATTGAATCCCGGAAG
CGACTTGCCAAGACAGTGCTGGTGTTTGTGGGCCTGTTCGCCTTCTGCTGGCTCCCCAAT
CATGTCATCTACCTGTACCGCTCCTACCACTACTCTGAGGTGGACACCTCCATGCTCCAC
TTTGTCACCAGCATCTGTGCCCGCCTCCTGGCCTTCACCAACTCCTGCGTGAACCCCTTT
GCCCTCTACCTGCTGAGCAAGAGTTTCAGGAAACAGTTCAACACTCAGCTGCTCTGTTGC
CAGCCTGGCCTGATCATCCGGTCTCACAGCACTGGAAGGAGTACAACCTGCATGACCTCC
CTCAAGAGTACCAACCCCTCCGTGGCCACCTTTAGCCTCATCAATGGAAACATCTGTCAC
GAGCGGTATGTCTAG
Protein Properties
Number of Residues 384
Molecular Weight 43198.3
Theoretical pI 8.53
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 39-62
  • 77-96
  • 115-136
  • 153-174
  • 209-234
  • 265-285
  • 299-325
Protein Sequence
>Gastrin-releasing peptide receptor
MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVIILIGLIGNIT
LIKIFCTVKSMRNVPNLFISSLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQ
LTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAAFIWIISMLLAIPEAVFSD
LHPFHEESTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKNLIQS
AYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLH
FVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLIIRSHSTGRSTTCMTS
LKSTNPSVATFSLINGNICHERYV
GenBank ID Protein 19744184
UniProtKB/Swiss-Prot ID P30550
UniProtKB/Swiss-Prot Entry Name GRPR_HUMAN
PDB IDs Not Available
GenBank Gene ID AF293323
GeneCard ID GRPR
GenAtlas ID GRPR
HGNC ID HGNC:4609
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Corjay MH, Dobrzanski DJ, Way JM, Viallet J, Shapira H, Worland P, Sausville EA, Battey JF: Two distinct bombesin receptor subtypes are expressed and functional in human lung carcinoma cells. J Biol Chem. 1991 Oct 5;266(28):18771-9. [PubMed:1655761 ]
  4. Xiao D, Wang J, Hampton LL, Weber HC: The human gastrin-releasing peptide receptor gene structure, its tissue expression and promoter. Gene. 2001 Feb 7;264(1):95-103. [PubMed:11245983 ]