Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07732
Secondary Accession Numbers
  • 13441
Name Homer protein homolog 1
Synonyms
  1. Homer-1
Gene Name HOMER1
Protein Type Unknown
Biological Properties
General Function Cell cycle control, cell division, chromosome partitioning
Specific Function Postsynaptic density scaffolding protein. Binds and cross-links cytoplasmic regions of GRM1, GRM5, ITPR1, DNM3, RYR1, RYR2, SHANK1 and SHANK3. By physically linking GRM1 and GRM5 with ER-associated ITPR1 receptors, it aids the coupling of surface receptors to intracellular calcium release. May also couple GRM1 to PI3 kinase through its interaction with AGAP2. Isoform 1 regulates the trafficking and surface expression of GRM5. Isoform 3 acts as a natural dominant negative, in dynamic competition with constitutively expressed isoform 1 to regulate synaptic metabotropic glutamate function. Isoform 3, may be involved in the structural changes that occur at synapses during long-lasting neuronal plasticity and development
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cytoplasm
  2. Cell junction
  3. Cell junction
  4. synapse
  5. synapse
  6. postsynaptic cell membrane
  7. postsynaptic density
Gene Properties
Chromosome Location Chromosome:5
Locus 5q14.2
SNPs HOMER1
Gene Sequence
>1065 bp
ATGGGGGAGCAGCCGATTTTCAGCACTCGAGCTCATGTCTTCCAAATTGACCCAAACACA
AAGAAGAACTGGGTACCCACCAGCAAGCATGCAGTTACTGTGTCTTATTTCTATGACAGC
ACAAGAAATGTGTATAGGATAATCAGTTTAGATGGCTCAAAGGCAATAATAAATAGTACC
ATCACCCCAAACATGACATTTACTAAAACATCTCAGAAGTTTGGCCAGTGGGCTGATAGC
CGGGCAAACACCGTTTATGGATTGGGATTCTCCTCTGAGCATCATCTTTCGAAATTTGCA
GAAAAGTTTCAGGAATTTAAAGAAGCTGCTCGACTAGCAAAGGAAAAATCACAAGAGAAG
ATGGAACTTACCAGTACACCTTCACAGGAATCCGCAGGCGGGGATCTTCAGTCTCCTTTA
ACACCGGAAAGTATCAACGGGACAGATGATGAAAGAACACCTGATGTGACACAGAACTCA
GAGCCAAGGGCTGAACCAACTCAGAATGCATTGCCATTTTCACATAGTTCAGCAATCAGC
AAACATTGGGAGGCTGAACTGGCTACCCTCAAAGGAAATAATGCCAAACTCACTGCAGCC
CTGCTGGAGTCCACTGCCAATGTGAAACAATGGAAACAGCAACTTGCTGCCTATCAAGAG
GAAGCAGAACGTCTGCACAAGCGGGTGACTGAACTTGAATGTGTTAGTAGCCAAGCAAAT
GCAGTACATACTCATAAGACAGAATTAAATCAGACAATACAAGAACTGGAAGAGACACTG
AAACTGAAGGAAGAGGAAATAGAAAGGTTAAAACAAGAAATTGATAATGCCAGAGAACTA
CAAGAACAGAGGGATTCTTTGACTCAGAAACTACAGGAAGTAGAAATTCGGAACAAAGAC
CTGGAGGGACAACTGTCTGACTTAGAGCAACGTCTGGAGAAAAGTCAGAATGAACAAGAA
GCTTTTCGCAATAACCTGAAGACACTCTTAGAAATTCTGGATGGAAAGATATTTGAACTA
ACAGAATTACGAGATAACTTGGCCAAGCTACTAGAATGCAGCTAA
Protein Properties
Number of Residues 354
Molecular Weight 40276.5
Theoretical pI 5.14
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Homer protein homolog 1
MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINST
ITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEK
MELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPTQNALPFSHSSAIS
KHWEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTELECVSSQAN
AVHTHKTELNQTIQELEETLKLKEEEIERLKQEIDNARELQEQRDSLTQKLQEVEIRNKD
LEGQLSDLEQRLEKSQNEQEAFRNNLKTLLEILDGKIFELTELRDNLAKLLECS
GenBank ID Protein 3834615
UniProtKB/Swiss-Prot ID Q86YM7
UniProtKB/Swiss-Prot Entry Name HOME1_HUMAN
PDB IDs
GenBank Gene ID AF093262
GeneCard ID HOMER1
GenAtlas ID HOMER1
HGNC ID HGNC:17512
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Xiao B, Tu JC, Petralia RS, Yuan JP, Doan A, Breder CD, Ruggiero A, Lanahan AA, Wenthold RJ, Worley PF: Homer regulates the association of group 1 metabotropic glutamate receptors with multivalent complexes of homer-related, synaptic proteins. Neuron. 1998 Oct;21(4):707-16. [PubMed:9808458 ]
  4. Roche KW, Tu JC, Petralia RS, Xiao B, Wenthold RJ, Worley PF: Homer 1b regulates the trafficking of group I metabotropic glutamate receptors. J Biol Chem. 1999 Sep 3;274(36):25953-7. [PubMed:10464340 ]
  5. Xiao B, Tu JC, Worley PF: Homer: a link between neural activity and glutamate receptor function. Curr Opin Neurobiol. 2000 Jun;10(3):370-4. [PubMed:10851183 ]