Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07733
Secondary Accession Numbers
  • 13442
Name Homer protein homolog 3
Synonyms
  1. Homer-3
Gene Name HOMER3
Protein Type Unknown
Biological Properties
General Function Involved in metabotropic glutamate receptor signaling p
Specific Function Postsynaptic density scaffolding protein. Binds and cross-links cytoplasmic regions of GRM1, GRM5, ITPR1, DNM3, RYR1, RYR2, SHANK1 and SHANK3. By physically linking GRM1 and GRM5 with ER-associated ITPR1 receptors, it aids the coupling of surface receptors to intracellular calcium release. Isoforms can be differently regulated and may play an important role in maintaining the plasticity at glutamatergic synapses
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cytoplasm
  2. Cell junction
  3. Cell junction
  4. synapse
  5. synapse
  6. postsynaptic cell membrane
  7. postsynaptic density
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.11
SNPs HOMER3
Gene Sequence
>1086 bp
ATGTCCACAGCCAGGGAGCAGCCAATCTTCAGCACACGGGCGCACGTGTTCCAAATTGAC
CCAGCCACCAAGCGAAACTGGATCCCAGCGGGCAAGCACGCACTCACTGTCTCCTATTTC
TACGATGCCACCCGCAATGTGTACCGCATCATCAGCATCGGAGGCGCCAAGGCCATCATC
AACAGCACTGTCACTCCCAACATGACCTTCACCAAAACTTCCCAGAAGTTCGGGCAGTGG
GCCGACAGTCGCGCCAACACAGTCTACGGCCTGGGCTTTGCCTCTGAACAGCATCTGACA
CAGTTTGCCGAGAAGTTCCAGGAAGTGAAGGAAGCAGCCAGGCTGGCCAGGGAGAAATCT
CAGGATGGCGGGGAGCTCACCAGTCCAGCCCTGGGGCTCGCCTCCCACCAGGTGCCCCCG
AGCCCTCTCGTCAGTGCCAACGGCCCCGGCGAGGAAAAACTGTTCCGCAGCCAGAGCGCT
GATGCCCCCGGCCCCACAGAGCGCGAGCGGCTAAAGAAGATGTTGTCTGAGGGCTCCGTG
GGCGAGGTACAGTGGGAGGCCGAGTTTTTCGCACTGCAGGACAGCAACAACAAGCTGGCA
GGCGCCCTGCGAGAGGCCAACGCCGCCGCAGCCCAGTGGAGGCAGCAGCTGGAGGCTCAG
CGTGCAGAGGCCGAGCGGCTGCGGCAGCGGGTGGCTGAGCTGGAGGCTCAGGCAGCTTCA
GAGGTGACCCCCACCGGTGAGAAGGAGGGGCTGGGCCAGGGCCAGTCGCTGGAACAGCTG
GAAGCTCTGGTGCAAACCAAGGACCAGGAGATTCAGACCCTGAAGAGTCAGACTGGGGGG
CCCCGCGAGGCCCTGGAGGCTGCCGAGCGTGAGGAGACTCAGCAGAAGGTGCAGGACCTG
GAGACCCGCAATGCGGAGTTGGAGCACCAGCTGCGGGCGATGGAGCGCAGCCTGGAGGAG
GCACGGGCAGAGCGGGAGCGGGCGCGGGCTGAGGTGGGCCGGGCAGCGCAGCTGCTGGAC
GTCAGCCTGTTTGAGCTGAGTGAGCTGCGTGAGGGCCTGGCCCGCCTGGCTGAGGCTGCG
CCCTGA
Protein Properties
Number of Residues 361
Molecular Weight 39836.0
Theoretical pI 5.15
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Homer protein homolog 3
MSTAREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAII
NSTVTPNMTFTKTSQKFGQWADSRANTVYGLGFASEQHLTQFAEKFQEVKEAARLAREKS
QDGGELTSPALGLASHQVPPSPLVSANGPGEEKLFRSQSADAPGPTERERLKKMLSEGSV
GEVQWEAEFFALQDSNNKLAGALREANAAAAQWRQQLEAQRAEAERLRQRVAELEAQAAS
EVTPTGEKEGLGQGQSLEQLEALVQTKDQEIQTLKSQTGGPREALEAAEREETQQKVQDL
ETRNAELEHQLRAMERSLEEARAERERARAEVGRAAQLLDVSLFELSELREGLARLAEAA
P
GenBank ID Protein 224809414
UniProtKB/Swiss-Prot ID Q9NSC5
UniProtKB/Swiss-Prot Entry Name HOME3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001145722.1
GeneCard ID HOMER3
GenAtlas ID HOMER3
HGNC ID HGNC:17514
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  5. Xiao B, Tu JC, Petralia RS, Yuan JP, Doan A, Breder CD, Ruggiero A, Lanahan AA, Wenthold RJ, Worley PF: Homer regulates the association of group 1 metabotropic glutamate receptors with multivalent complexes of homer-related, synaptic proteins. Neuron. 1998 Oct;21(4):707-16. [PubMed:9808458 ]
  6. Soloviev MM, Ciruela F, Chan WY, McIlhinney RA: Molecular characterisation of two structurally distinct groups of human homers, generated by extensive alternative splicing. J Mol Biol. 2000 Feb 4;295(5):1185-200. [PubMed:10653696 ]