Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07750
Secondary Accession Numbers
  • 13459
Name Kv channel-interacting protein 1
Synonyms
  1. A-type potassium channel modulatory protein 1
  2. KChIP1
  3. Potassium channel-interacting protein 1
  4. Vesicle APC-binding protein
Gene Name KCNIP1
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Probably modulates channels density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND1/Kv4.1 and KCND2/Kv4.2 currents. Seems to be involved in KCND2 trafficking to the cell surface
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Cellular Location
  1. Cell membrane
  2. Peripheral membrane protein
Gene Properties
Chromosome Location Chromosome:5
Locus 5q35.1
SNPs KCNIP1
Gene Sequence
>684 bp
ATGGGGGCCGTCATGGGCACCTTCTCATCTCTGCAAACCAAACAAAGGCGACCCTCGAAA
GACATCGCCTGGTGGTATTACCAGTATCAGAGAGATAAGATTGAAGATGAGCTGGAGATG
ACCATGGTTTGCCATCGGCCCGAGGGACTGGAGCAGCTCGAGGCCCAGACCAACTTCACC
AAGAGGGAGCTGCAGGTCCTTTATCGAGGCTTCAAAAATGAGTGCCCCAGTGGTGTGGTC
AACGAAGACACATTCAAGCAGATCTATGCTCAGTTTTTCCCTCATGGAGATGCCAGCACG
TATGCCCATTACCTCTTCAATGCCTTCGACACCACTCAGACAGGCTCCGTGAAGTTCGAG
GACTTTGTAACCGCTCTGTCGATTTTATTGAGAGGAACTGTCCACGAGAAACTAAGGTGG
ACATTTAATTTGTATGACATCAACAAGGACGGATACATAAACAAAGAGGAGATGATGGAC
ATTGTCAAAGCCATCTATGACATGATGGGGAAATACACATATCCTGTGCTCAAAGAGGAC
ACTCCAAGGCAGCATGTGGACGTCTTCTTCCAGAAAATGGACAAAAATAAAGATGGCATC
GTAACTTTAGATGAATTTCTTGAATCATGTCAGGAGGACGACAACATCATGAGGTCTCTC
CAGCTGTTTCAAAATGTCATGTAA
Protein Properties
Number of Residues 227
Molecular Weight 26817.3
Theoretical pI 4.89
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Kv channel-interacting protein 1
MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQRDKIEDELEMTMVCHRPEGLEQLEAQTNFT
KRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFE
DFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKED
TPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM
GenBank ID Protein 78190480
UniProtKB/Swiss-Prot ID Q9NZI2
UniProtKB/Swiss-Prot Entry Name KCIP1_HUMAN
PDB IDs
GenBank Gene ID NM_001034837.1
GeneCard ID KCNIP1
GenAtlas ID KCNIP1
HGNC ID HGNC:15521
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. An WF, Bowlby MR, Betty M, Cao J, Ling HP, Mendoza G, Hinson JW, Mattsson KI, Strassle BW, Trimmer JS, Rhodes KJ: Modulation of A-type potassium channels by a family of calcium sensors. Nature. 2000 Feb 3;403(6769):553-6. [PubMed:10676964 ]
  3. Shibata R, Misonou H, Campomanes CR, Anderson AE, Schrader LA, Doliveira LC, Carroll KI, Sweatt JD, Rhodes KJ, Trimmer JS: A fundamental role for KChIPs in determining the molecular properties and trafficking of Kv4.2 potassium channels. J Biol Chem. 2003 Sep 19;278(38):36445-54. Epub 2003 Jun 26. [PubMed:12829703 ]
  4. Van Hoorick D, Raes A, Keysers W, Mayeur E, Snyders DJ: Differential modulation of Kv4 kinetics by KCHIP1 splice variants. Mol Cell Neurosci. 2003 Oct;24(2):357-66. [PubMed:14572458 ]
  5. Nakamura TY, Nandi S, Pountney DJ, Artman M, Rudy B, Coetzee WA: Different effects of the Ca(2+)-binding protein, KChIP1, on two Kv4 subfamily members, Kv4.1 and Kv4.2. FEBS Lett. 2001 Jun 22;499(3):205-9. [PubMed:11423117 ]
  6. Lin YL, Lin SR, Wu TT, Chang LS: Evidence showing an intermolecular interaction between KChIP proteins and Taiwan cobra cardiotoxins. Biochem Biophys Res Commun. 2004 Jul 2;319(3):720-4. [PubMed:15184042 ]
  7. Lin YL, Chen CY, Cheng CP, Chang LS: Protein-protein interactions of KChIP proteins and Kv4.2. Biochem Biophys Res Commun. 2004 Aug 27;321(3):606-10. [PubMed:15358149 ]
  8. Scannevin RH, Wang K, Jow F, Megules J, Kopsco DC, Edris W, Carroll KC, Lu Q, Xu W, Xu Z, Katz AH, Olland S, Lin L, Taylor M, Stahl M, Malakian K, Somers W, Mosyak L, Bowlby MR, Chanda P, Rhodes KJ: Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1. Neuron. 2004 Feb 19;41(4):587-98. [PubMed:14980207 ]
  9. Pioletti M, Findeisen F, Hura GL, Minor DL Jr: Three-dimensional structure of the KChIP1-Kv4.3 T1 complex reveals a cross-shaped octamer. Nat Struct Mol Biol. 2006 Nov;13(11):987-95. Epub 2006 Oct 22. [PubMed:17057713 ]
  10. Wang H, Yan Y, Liu Q, Huang Y, Shen Y, Chen L, Chen Y, Yang Q, Hao Q, Wang K, Chai J: Structural basis for modulation of Kv4 K+ channels by auxiliary KChIP subunits. Nat Neurosci. 2007 Jan;10(1):32-9. Epub 2006 Dec 24. [PubMed:17187064 ]