You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07754
Secondary Accession Numbers
  • 13463
Name Calcium-activated potassium channel subunit beta-2
Synonyms
  1. BK channel subunit beta-2
  2. BKbeta2
  3. Calcium-activated potassium channel, subfamily M subunit beta-2
  4. Charybdotoxin receptor subunit beta-2
  5. Hbeta2
  6. Hbeta3
  7. K(VCA)beta-2
  8. Maxi K channel subunit beta-2
  9. Slo-beta-2
Gene Name KCNMB2
Protein Type Unknown
Biological Properties
General Function Involved in calcium-activated potassium channel activity
Specific Function Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Acts as a negative regulator that confers rapid and complete inactivation of KCNMA1 channel complex. May participate in KCNMA1 inactivation in chromaffin cells of the adrenal gland or in hippocampal CA1 neurons
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
calcium activated cation channel activity
calcium-activated potassium channel activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
Process
establishment of localization
transport
monovalent inorganic cation transport
potassium ion transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:3
Locus 3q26.32
SNPs KCNMB2
Gene Sequence
>708 bp
ATGTTTATATGGACCAGTGGCCGGACCTCTTCATCTTATAGACATGATGAAAAAAGAAAT
ATTTACCAGAAAATCAGGGACCATGACCTCCTGGACAAAAGGAAAACAGTCACAGCACTG
AAGGCAGGAGAGGACCGAGCTATTCTCCTGGGACTGGCTATGATGGTGTGCTCCATCATG
ATGTATTTTCTGCTGGGAATCACACTCCTGCGCTCATACATGCAGAGCGTGTGGACCGAA
GAGTCTCAATGCACCTTGCTGAATGCGTCCATCACGGAAACATTTAACTGCTCCTTCAGC
TGTGGTCCAGACTGCTGGAAACTTTCTCAGTACCCCTGCCTCCAGGTGTACGTTAACCTG
ACTTCTTCCGGGGAAAAGCTCCTCCTCTACCACACAGAAGAGACAATAAAAATCAATCAG
AAGTGCTCCTATATACCTAAATGTGGAAAAAATTTTGAAGAATCCATGTCCCTGGTGAAT
GTTGTCATGGAAAACTTCAGGAAGTATCAACACTTCTCCTGCTATTCTGACCCAGAAGGA
AACCAGAAGAGTGTTATCCTAACCAAACTCTACAGTTCCAACGTGCTGTTCCATTCACTC
TTCTGGCCAACCTGTATGATGGCTGGGGGTGTGGCAATTGTTGCCATGGTGAAACTTACA
CAGTACCTCTCCCTACTATGTGAGAGGATCCAACGGATCAATAGATAA
Protein Properties
Number of Residues 235
Molecular Weight 27129.4
Theoretical pI 8.47
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 47-67
  • 195-215
Protein Sequence
>Calcium-activated potassium channel subunit beta-2
MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIM
MYFLLGITLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNL
TSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEG
NQKSVILTKLYSSNVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR
GenBank ID Protein 4566497
UniProtKB/Swiss-Prot ID Q9Y691
UniProtKB/Swiss-Prot Entry Name KCMB2_HUMAN
PDB IDs
GenBank Gene ID AF099137
GeneCard ID KCNMB2
GenAtlas ID KCNMB2
HGNC ID HGNC:6286
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Wallner M, Meera P, Toro L: Molecular basis of fast inactivation in voltage and Ca2+-activated K+ channels: a transmembrane beta-subunit homolog. Proc Natl Acad Sci U S A. 1999 Mar 30;96(7):4137-42. [PubMed:10097176 ]
  3. Brenner R, Jegla TJ, Wickenden A, Liu Y, Aldrich RW: Cloning and functional characterization of novel large conductance calcium-activated potassium channel beta subunits, hKCNMB3 and hKCNMB4. J Biol Chem. 2000 Mar 3;275(9):6453-61. [PubMed:10692449 ]
  4. Meera P, Wallner M, Toro L: A neuronal beta subunit (KCNMB4) makes the large conductance, voltage- and Ca2+-activated K+ channel resistant to charybdotoxin and iberiotoxin. Proc Natl Acad Sci U S A. 2000 May 9;97(10):5562-7. [PubMed:10792058 ]
  5. Orio P, Rojas P, Ferreira G, Latorre R: New disguises for an old channel: MaxiK channel beta-subunits. News Physiol Sci. 2002 Aug;17:156-61. [PubMed:12136044 ]
  6. Xia XM, Ding JP, Lingle CJ: Molecular basis for the inactivation of Ca2+- and voltage-dependent BK channels in adrenal chromaffin cells and rat insulinoma tumor cells. J Neurosci. 1999 Jul 1;19(13):5255-64. [PubMed:10377337 ]
  7. Xia XM, Ding JP, Lingle CJ: Inactivation of BK channels by the NH2 terminus of the beta2 auxiliary subunit: an essential role of a terminal peptide segment of three hydrophobic residues. J Gen Physiol. 2003 Feb;121(2):125-48. [PubMed:12566540 ]
  8. Bentrop D, Beyermann M, Wissmann R, Fakler B: NMR structure of the "ball-and-chain" domain of KCNMB2, the beta 2-subunit of large conductance Ca2+- and voltage-activated potassium channels. J Biol Chem. 2001 Nov 9;276(45):42116-21. Epub 2001 Aug 21. [PubMed:11517232 ]