Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07756
Secondary Accession Numbers
  • 13465
Name Calcium-activated potassium channel subunit beta-4
Synonyms
  1. BK channel subunit beta-4
  2. BKbeta4
  3. Calcium-activated potassium channel, subfamily M subunit beta-4
  4. Charybdotoxin receptor subunit beta-4
  5. Hbeta4
  6. K(VCA)beta-4
  7. Maxi K channel subunit beta-4
  8. Slo-beta-4
Gene Name KCNMB4
Protein Type Unknown
Biological Properties
General Function Involved in calcium-activated potassium channel activity
Specific Function Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Decreases the gating kinetics and calcium sensitivity of the KCNMA1 channel, but with fast deactivation kinetics. May decrease KCNMA1 channel openings at low calcium concentrations but increases channel openings at high calcium concentrations. Makes KCNMA1 channel resistant to 100 nM charybdotoxin (CTX) toxin concentrations
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
calcium activated cation channel activity
calcium-activated potassium channel activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
Process
establishment of localization
transport
monovalent inorganic cation transport
potassium ion transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 12q
SNPs KCNMB4
Gene Sequence
>633 bp
ATGGCGAAGCTCCGGGTGGCTTACGAGTACACGGAAGCCGAGGACAAGAGCATCCGGCTC
GGCTTGTTTCTCATCATCTCCGGCGTCGTGTCGCTCTTCATCTTCGGCTTCTGCTGGCTG
AGTCCCGCGCTGCAGGATCTGCAAGCCACGGAGGCCAATTGCACGGTGCTGTCGGTGCAG
CAGATCGGCGAGGTGTTCGAGTGCACCTTCACCTGTGGCGCCGACTGCAGGGGCACCTCG
CAGTACCCCTGCGTCCAGGTCTACGTGAACAACTCTGAGTCCAACTCTAGGGCGCTGCTG
CACAGCGACGAGCACCAGCTCCTGACCAACCCCAAGTGCTCCTATATCCCTCCCTGTAAG
AGAGAAAATCAGAAGAATTTGGAAAGTGTCATGAATTGGCAACAGTACTGGAAAGATGAG
ATTGGTTCCCAGCCATTTACTTGCTATTTTAATCAACATCAAAGACCAGATGATGTGCTT
CTGCATCGCACTCATGATGAGATTGTCCTCCTGCATTGCTTCCTCTGGCCCCTGGTGACA
TTTGTGGTGGGCGTTCTCATTGTGGTCCTGACCATCTGTGCCAAGAGCTTGGCGATCAAG
GCGGAAGCCATGAAGAAGCGCAAGTTCTCTTAA
Protein Properties
Number of Residues 210
Molecular Weight 23948.5
Theoretical pI 6.75
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 20-40
  • 168-188
Protein Sequence
>Calcium-activated potassium channel subunit beta-4
MAKLRVAYEYTEAEDKSIRLGLFLIISGVVSLFIFGFCWLSPALQDLQATEANCTVLSVQ
QIGEVFECTFTCGADCRGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCK
RENQKNLESVMNWQQYWKDEIGSQPFTCYFNQHQRPDDVLLHRTHDEIVLLHCFLWPLVT
FVVGVLIVVLTICAKSLAVKAEAMKKRKFS
GenBank ID Protein 7799988
UniProtKB/Swiss-Prot ID Q86W47
UniProtKB/Swiss-Prot Entry Name KCMB4_HUMAN
PDB IDs Not Available
GenBank Gene ID AF160967
GeneCard ID KCNMB4
GenAtlas ID KCNMB4
HGNC ID HGNC:6289
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Brenner R, Jegla TJ, Wickenden A, Liu Y, Aldrich RW: Cloning and functional characterization of novel large conductance calcium-activated potassium channel beta subunits, hKCNMB3 and hKCNMB4. J Biol Chem. 2000 Mar 3;275(9):6453-61. [PubMed:10692449 ]
  3. Meera P, Wallner M, Toro L: A neuronal beta subunit (KCNMB4) makes the large conductance, voltage- and Ca2+-activated K+ channel resistant to charybdotoxin and iberiotoxin. Proc Natl Acad Sci U S A. 2000 May 9;97(10):5562-7. [PubMed:10792058 ]
  4. Orio P, Rojas P, Ferreira G, Latorre R: New disguises for an old channel: MaxiK channel beta-subunits. News Physiol Sci. 2002 Aug;17:156-61. [PubMed:12136044 ]
  5. Behrens R, Nolting A, Reimann F, Schwarz M, Waldschutz R, Pongs O: hKCNMB3 and hKCNMB4, cloning and characterization of two members of the large-conductance calcium-activated potassium channel beta subunit family. FEBS Lett. 2000 May 26;474(1):99-106. [PubMed:10828459 ]
  6. Weiger TM, Holmqvist MH, Levitan IB, Clark FT, Sprague S, Huang WJ, Ge P, Wang C, Lawson D, Jurman ME, Glucksmann MA, Silos-Santiago I, DiStefano PS, Curtis R: A novel nervous system beta subunit that downregulates human large conductance calcium-dependent potassium channels. J Neurosci. 2000 May 15;20(10):3563-70. [PubMed:10804197 ]
  7. Jin P, Weiger TM, Wu Y, Levitan IB: Phosphorylation-dependent functional coupling of hSlo calcium-dependent potassium channel and its hbeta 4 subunit. J Biol Chem. 2002 Mar 22;277(12):10014-20. Epub 2002 Jan 14. [PubMed:11790768 ]
  8. Jin P, Weiger TM, Levitan IB: Reciprocal modulation between the alpha and beta 4 subunits of hSlo calcium-dependent potassium channels. J Biol Chem. 2002 Nov 15;277(46):43724-9. Epub 2002 Sep 9. [PubMed:12223479 ]