You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07757
Secondary Accession Numbers
  • 13466
Name Small conductance calcium-activated potassium channel protein 1
Synonyms
  1. KCa2.1
  2. SK1
  3. SKCa 1
  4. SKCa1
Gene Name KCNN1
Protein Type Unknown
Biological Properties
General Function Involved in calmodulin binding
Specific Function Forms a voltage-independent potassium channel activated by intracellular calcium. Activation is followed by membrane hyperpolarization. Thought to regulate neuronal excitability by contributing to the slow component of synaptic afterhyperpolarization. The channel is blocked by apamin
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
binding
small conductance calcium-activated potassium channel activity
calmodulin binding
protein binding
calcium activated cation channel activity
calcium-activated potassium channel activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
Process
establishment of localization
transport
monovalent inorganic cation transport
potassium ion transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.1
SNPs KCNN1
Gene Sequence
>1632 bp
ATGAACAGCCACAGCTACAATGGCAGCGTGGGGCGGCCGCTGGGCAGCGGGCCGGGCGCC
CTGGGACGAGACCCTCCGGACCCTGAGGCCGGCCACCCCCCACAACCCCCGCACAGCCCG
GGCCTCCAGGTGGTAGTGGCCAAGAGTGAGCCAGCCCGGCCCTCACCCGGCAGCCCCCGG
GGGCAGCCCCAGGACCAGGACGATGACGAGGATGATGAGGAAGATGAGGCCGGCAGGCAG
AGAGCCTCGGGGAAACCCTCAAATGTGGGCCACCGCCTGGGCCACCGGCGGGCGCTCTTC
GAGAAGCGGAAGCGCCTCAGCGACTATGCCCTCATTTTCGGCATGTTTGGCATCGTCGTC
ATGGTGACGGAGACCGAGCTGTCCTGGGGGGTGTACACCAAGGAGTCTCTGTACTCATTC
GCACTCAAATGCCTCATCAGCCTCTCCACGGCCATCCTGCTGGGTCTCGTTGTCCTCTAC
CATGCCCGGGAGATCCAGCTGTTCATGGTGGACAACGGGGCTGATGACTGGCGCATCGCC
ATGACCTGCGAGCGCGTGTTCCTCATCTCGCTAGAGCTGGCAGTGTGCGCCATTCACCCG
GTGCCCGGCCACTACCGCTTCACGTGGACGGCGCGGCTGGCCTTCACGTACGCGCCCTCG
GTGGCCGAGGCCGACGTGGACGTGCTGCTGTCCATCCCCATGTTCCTGCGCCTCTACCTG
CTGGGCCGGGTGATGCTACTGCACAGCAAAATCTTCACGGACGCCTCGAGCCGCAGCATC
GGGGCCCTCAACAAGATCACCTTCAACACGCGCTTCGTCATGAAGACACTCATGACCATC
TGCCCCGGCACCGTGCTGCTGGTCTTCAGCATCTCCTCCTGGATCATCGCAGCCTGGACC
GTGCGCGTCTGCGAGAGGTACCACGACAAGCAGGAAGTGACCAGCAACTTCCTGGGGGCC
ATGTGGCTGATTTCCATCACCTTCCTCTCCATTGGCTACGGCGACATGGTGCCCCACACC
TACTGCGGGAAGGGTGTGTGCCTGCTCACTGGCATCATGGGAGCTGGCTGTACCGCGCTC
GTGGTGGCTGTGGTGGCTCGGAAGCTGGAGCTCACCAAGGCTGAGAAGCACGTGCACAAC
TTCATGATGGACACTCAGCTCACCAAGCGGGTAAAAAACGCCGCTGCTAACGTTCTCAGG
GAGACGTGGCTCATCTACAAACATACCAGGCTGGTGAAGAAGCCAGACCAAGCCCGGGTT
CGGAAACACCAGCGTAAGTTCCTCCAAGCCATCCATCAGGCTCAGAAGCTCCGGAGTGTG
AAGATCGAGCAAGGGAAGCTGAACGACCAGGCTAACACGCTTACCGACCTAGCCAAGACC
CAGACCGTCATGTACGACCTTGTATCGGAGCTGCACGCTCAGCACGAGGAGCTGGAGGCC
CGCCTGGCCACCCTGGAAAGCCGCTTGGATGCGCTGGGTGCCTCTCTACAGGCCCTGCCT
GGCCTCATCGCCCAAGCCATACGCCCACCCCCGCCTCCCCTGCCTCCCAGGCCCGGCCCC
GGCCCCCAAGACCAGGCAGCCCGGAGCTCCCCCTGCCGGTGGACGCCCGTGGCCCCCTCG
GACTGCGGGTGA
Protein Properties
Number of Residues 543
Molecular Weight 59986.9
Theoretical pI 9.05
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 111-131
  • 140-160
  • 179-199
  • 228-248
  • 277-297
  • 346-366
Protein Sequence
>Small conductance calcium-activated potassium channel protein 1
MNSHSYNGSVGRPLGSGPGALGRDPPDPEAGHPPQPPHSPGLQVVVAKSEPARPSPGSPR
GQPQDQDDDEDDEEDEAGRQRASGKPSNVGHRLGHRRALFEKRKRLSDYALIFGMFGIVV
MVTETELSWGVYTKESLYSFALKCLISLSTAILLGLVVLYHAREIQLFMVDNGADDWRIA
MTCERVFLISLELAVCAIHPVPGHYRFTWTARLAFTYAPSVAEADVDVLLSIPMFLRLYL
LGRVMLLHSKIFTDASSRSIGALNKITFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWT
VRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTAL
VVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQARV
RKHQRKFLQAIHQAQKLRSVKIEQGKLNDQANTLTDLAKTQTVMYDLVSELHAQHEELEA
RLATLESRLDALGASLQALPGLIAQAIRPPPPPLPPRPGPGPQDQAARSSPCRWTPVAPS
DCG
GenBank ID Protein 25777643
UniProtKB/Swiss-Prot ID Q92952
UniProtKB/Swiss-Prot Entry Name KCNN1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_002248.3
GeneCard ID KCNN1
GenAtlas ID KCNN1
HGNC ID HGNC:6290
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  3. Kohler M, Hirschberg B, Bond CT, Kinzie JM, Marrion NV, Maylie J, Adelman JP: Small-conductance, calcium-activated potassium channels from mammalian brain. Science. 1996 Sep 20;273(5282):1709-14. [PubMed:8781233 ]
  4. Litt M, LaMorticella D, Bond CT, Adelman JP: Gene structure and chromosome mapping of the human small-conductance calcium-activated potassium channel SK1 gene (KCNN1). Cytogenet Cell Genet. 1999;86(1):70-3. [PubMed:10516439 ]