Hmdb loader
Identification
HMDB Protein ID HMDBP07776
Secondary Accession Numbers
  • 13485
Name Protein lin-7 homolog B
Synonyms
  1. Lin-7B
  2. MALS-2
  3. Mammalian lin-seven protein 2
  4. Veli-2
  5. Vertebrate lin-7 homolog 2
  6. hLin7B
  7. hVeli2
Gene Name LIN7B
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells. May increase the amplitude of ACCN3 acid-evoked currents by stabilizing the channel at the cell surface
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
Cellular Location
  1. Cell membrane
  2. Peripheral membrane protein
  3. Peripheral membrane protein
  4. Peripheral membrane protein
  5. Basolateral cell membrane
  6. Cell junction
  7. Cell junction
  8. Cell junction
  9. Cell junction
  10. synapse
  11. synapse
  12. tight junction
  13. postsynaptic cell membrane
  14. postsynaptic density
  15. synaptosome
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.3
SNPs LIN7B
Gene Sequence
>624 bp
ATGGCTGCGCTGGTGGAGCCGCTGGGGCTGGAGCGGGACGTGTCCCGGGCGGTTGAGCTC
CTCGAGCGGCTCCAGCGCAGCGGGGAGCTGCCGCCGCAGAAGCTGCAGGCCCTCCAGCGA
GTTCTGCAGAGCCGCTTCTGCTCCGCTATCCGAGAGGTGTATGAGCAGCTTTATGACACG
CTGGACATCACCGGCAGCGCCGAGATCCGAGCCCATGCCACAGCCAAGGCCACAGTGGCT
GCCTTCACAGCCAGCGAGGGCCACGCACATCCCAGGGTAGTGGAGCTACCCAAGACGGAT
GAGGGCCTAGGCTTCAACATCATGGGTGGCAAAGAGCAAAACTCGCCCATCTACATCTCC
CGGGTCATCCCAGGGGGTGTGGCTGACCGCCATGGAGGCCTCAAGCGTGGGGATCAACTG
TTGTCGGTGAACGGTGTGAGCGTTGAGGGTGAGCAGCATGAGAAGGCGGTGGAGCTGCTG
AAGGCGGCCCAGGGCTCGGTGAAGCTGGTTGTCCGTTACACACCGCGAGTGCTGGAGGAG
ATGGAGGCCCGGTTCGAGAAGATGCGCTCTGCCCGCCGGCGCCAACAGCATCAGAGCTAC
TCGTCCTTGGAGTCTCGAGGTTGA
Protein Properties
Number of Residues 207
Molecular Weight 22895.9
Theoretical pI 9.01
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Protein lin-7 homolog B
MAALVEPLGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDT
LDITGSAEIRAHATAKATVAAFTASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYIS
RVIPGGVADRHGGLKRGDQLLSVNGVSVEGEQHEKAVELLKAAQGSVKLVVRYTPRVLEE
MEARFEKMRSARRRQQHQSYSSLESRG
GenBank ID Protein 11321325
UniProtKB/Swiss-Prot ID Q9HAP6
UniProtKB/Swiss-Prot Entry Name LIN7B_HUMAN
PDB IDs
GenBank Gene ID AF311862
GeneCard ID LIN7B
GenAtlas ID LIN7B
HGNC ID HGNC:17788
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [PubMed:12975309 ]
  3. Shelly M, Mosesson Y, Citri A, Lavi S, Zwang Y, Melamed-Book N, Aroeti B, Yarden Y: Polar expression of ErbB-2/HER2 in epithelia. Bimodal regulation by Lin-7. Dev Cell. 2003 Sep;5(3):475-86. [PubMed:12967566 ]
  4. Bohl J, Brimer N, Lyons C, Vande Pol SB: The stardust family protein MPP7 forms a tripartite complex with LIN7 and DLG1 that regulates the stability and localization of DLG1 to cell junctions. J Biol Chem. 2007 Mar 30;282(13):9392-400. Epub 2007 Jan 19. [PubMed:17237226 ]
  5. Olsen O, Liu H, Wade JB, Merot J, Welling PA: Basolateral membrane expression of the Kir 2.3 channel is coordinated by PDZ interaction with Lin-7/CASK complex. Am J Physiol Cell Physiol. 2002 Jan;282(1):C183-95. [PubMed:11742811 ]
  6. Hruska-Hageman AM, Benson CJ, Leonard AS, Price MP, Welsh MJ: PSD-95 and Lin-7b interact with acid-sensing ion channel-3 and have opposite effects on H+- gated current. J Biol Chem. 2004 Nov 5;279(45):46962-8. Epub 2004 Aug 17. [PubMed:15317815 ]
  7. Sudo K, Ito H, Iwamoto I, Morishita R, Asano T, Nagata K: Identification of a cell polarity-related protein, Lin-7B, as a binding partner for a Rho effector, Rhotekin, and their possible interaction in neurons. Neurosci Res. 2006 Dec;56(4):347-55. Epub 2006 Sep 18. [PubMed:16979770 ]