You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07780
Secondary Accession Numbers
  • 13489
Name Leukocyte immunoglobulin-like receptor subfamily B member 2
Synonyms
  1. CD85 antigen-like family member D
  2. CD85d antigen
  3. ILT-4
  4. Immunoglobulin-like transcript 4
  5. LIR-2
  6. Leukocyte immunoglobulin-like receptor 2
  7. MIR-10
  8. Monocyte/macrophage immunoglobulin-like receptor 10
Gene Name LILRB2
Protein Type Unknown
Biological Properties
General Function Involved in receptor activity
Specific Function Receptor for class I MHC antigens. Recognizes a broad spectrum of HLA-A, HLA-B, HLA-C and HLA-G alleles. Involved in the down-regulation of the immune response and the development of tolerance. Competes with CD8A for binding to class I MHC antigens. Inhibits FCGR1A-mediated phosphorylation of cellular proteins and mobilization of intracellular calcium ions
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.4
SNPs LILRB2
Gene Sequence
>1797 bp
ATGACCCCCATCGTCACAGTCCTGATCTGTCTCGGGCTGAGTCTGGGCCCCAGGACCCAC
GTGCAGACAGGGACCATTCCCAAGCCCACCCTGTGGGCTGAGCCAGACTCTGTGATCACC
CAGGGGAGTCCCGTCACCCTCAGTTGTCAGGGGAGCCTTGAAGCCCAGGAGTACCGTCTA
TATAGGGAGAAAAAATCAGCATCTTGGATTACACGGATACGACCAGAGCTTGTGAAGAAC
GGCCAGTTCCACATCCCATCCATCACCTGGGAACACACAGGGCGATATGGCTGTCAGTAT
TACAGCCGCGCTCGGTGGTCTGAGCTCAGTGACCCCCTGGTGCTGGTGATGACAGGAGCC
TACCCAAAACCCACCCTCTCAGCCCAGCCCAGCCCTGTGGTGACCTCAGGAGGAAGGGTG
ACCCTCCAGTGTGAGTCACAGGTGGCATTTGGCGGCTTCATTCTGTGTAAGGAAGGAGAA
GAAGAACACCCACAATGCCTGAACTCCCAGCCCCATGCCCGTGGGTCGTCCCGCGCCATC
TTCTCCGTGGGCCCCGTGAGCCCGAATCGCAGGTGGTCGCACAGGTGCTATGGTTATGAC
TTGAACTCTCCCTATGTGTGGTCTTCACCCAGTGATCTCCTGGAGCTCCTGGTCCCAGGT
GTTTCTAAGAAGCCATCACTCTCAGTGCAGCCGGGTCCTGTCGTGGCCCCTGGGGAAAGC
CTGACCCTCCAGTGTGTCTCTGATGTCGGCTATGACAGATTTGTTCTGTACAAGGAGGGG
GAACGTGACCTTCGCCAGCTCCCTGGCCGGCAGCCCCAGGCTGGGCTCTCCCAGGCCAAC
TTCACCCTGGGCCCTGTGAGCCGCTCCTACGGGGGCCAGTACAGATGCTACGGTGCACAC
AACCTCTCCTCTGAGTGCTCGGCCCCCAGCGACCCCCTGGACATCCTGATCACAGGACAG
ATCCGTGGCACACCCTTCATCTCAGTGCAGCCAGGCCCCACAGTGGCCTCAGGAGAGAAC
GTGACCCTGCTGTGTCAGTCATGGCGGCAGTTCCACACTTTCCTTCTGACCAAGGCGGGA
GCAGCTGATGCCCCACTCCGTCTAAGATCAATACACGAATATCCTAAGTACCAGGCTGAA
TTCCCCATGAGTCCTGTGACCTCAGCCCACGCGGGGACCTACAGGTGCTACGGCTCACTC
AACTCCGACCCCTACCTGCTGTCTCACCCCAGTGAGCCCCTGGAGCTCGTGGTCTCAGGA
CCCTCCATGGGTTCCAGCCCCCCACCCACCGGTCCCATCTCCACACCTGCAGGCCCTGAG
GACCAGCCCCTCACCCCCACTGGGTCGGATCCCCAAAGTGGTCTGGGAAGGCACCTGGGG
GTTGTGATCGGCATCTTGGTGGCCGTCGTCCTACTGCTCCTCCTCCTCCTCCTCCTCTTC
CTCATCCTCCGACATCGACGTCAGGGCAAACACTGGACATCGACCCAGAGAAAGGCTGAT
TTCCAACATCCTGCAGGGGCTGTGGGGCCAGAGCCCACAGACAGAGGCCTGCAGTGGAGG
TCCAGCCCAGCTGCCGACGCCCAGGAAGAAAACCTCTATGCTGCCGTGAAGGACACACAG
CCTGAAGATGGGGTGGAGATGGACACTCGGGCTGCTGCATCTGAAGCCCCCCAGGATGTG
ACCTACGCCCAGCTGCACAGCTTGACCCTCAGACGGAAGGCAACTGAGCCTCCTCCATCC
CAGGAAAGGGAACCTCCAGCTGAGCCCAGCATCTACGCCACCCTGGCCATCCACTAG
Protein Properties
Number of Residues 598
Molecular Weight 65133.1
Theoretical pI 7.22
Pfam Domain Function Not Available
Signals
  • 1-21
Transmembrane Regions
  • 462-482
Protein Sequence
>Leukocyte immunoglobulin-like receptor subfamily B member 2
MTPIVTVLICLGLSLGPRTHVQTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRL
YREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGA
YPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAI
FSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGES
LTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAY
NLSSEWSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAG
AADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSG
PSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRHLGVVIGILVAVVLLLLLLLLLF
LILRHRRQGKHWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKDTQ
PEDGVEMDTRAAASEAPQDVTYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATLAIH
GenBank ID Protein 125988400
UniProtKB/Swiss-Prot ID Q8N423
UniProtKB/Swiss-Prot Entry Name LIRB2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_005874.3
GeneCard ID LILRB2
GenAtlas ID LILRB2
HGNC ID HGNC:6606
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  3. Fanger NA, Cosman D, Peterson L, Braddy SC, Maliszewski CR, Borges L: The MHC class I binding proteins LIR-1 and LIR-2 inhibit Fc receptor-mediated signaling in monocytes. Eur J Immunol. 1998 Nov;28(11):3423-34. [PubMed:9842885 ]
  4. Borges L, Hsu ML, Fanger N, Kubin M, Cosman D: A family of human lymphoid and myeloid Ig-like receptors, some of which bind to MHC class I molecules. J Immunol. 1997 Dec 1;159(11):5192-6. [PubMed:9548455 ]
  5. Chang CC, Ciubotariu R, Manavalan JS, Yuan J, Colovai AI, Piazza F, Lederman S, Colonna M, Cortesini R, Dalla-Favera R, Suciu-Foca N: Tolerization of dendritic cells by T(S) cells: the crucial role of inhibitory receptors ILT3 and ILT4. Nat Immunol. 2002 Mar;3(3):237-43. Epub 2002 Jan 28. [PubMed:11875462 ]
  6. Shiroishi M, Tsumoto K, Amano K, Shirakihara Y, Colonna M, Braud VM, Allan DS, Makadzange A, Rowland-Jones S, Willcox B, Jones EY, van der Merwe PA, Kumagai I, Maenaka K: Human inhibitory receptors Ig-like transcript 2 (ILT2) and ILT4 compete with CD8 for MHC class I binding and bind preferentially to HLA-G. Proc Natl Acad Sci U S A. 2003 Jul 22;100(15):8856-61. Epub 2003 Jul 9. [PubMed:12853576 ]
  7. Willcox BE, Thomas LM, Chapman TL, Heikema AP, West AP Jr, Bjorkman PJ: Crystal structure of LIR-2 (ILT4) at 1.8 A: differences from LIR-1 (ILT2) in regions implicated in the binding of the Human Cytomegalovirus class I MHC homolog UL18. BMC Struct Biol. 2002 Oct 11;2:6. [PubMed:12390682 ]