Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07781
Secondary Accession Numbers
  • 13490
Name Leukocyte immunoglobulin-like receptor subfamily B member 4
Synonyms
  1. CD85 antigen-like family member K
  2. CD85k antigen
  3. ILT-3
  4. Immunoglobulin-like transcript 3
  5. LIR-5
  6. Leukocyte immunoglobulin-like receptor 5
  7. Monocyte inhibitory receptor HM18
Gene Name LILRB4
Protein Type Unknown
Biological Properties
General Function Involved in antigen binding
Specific Function Receptor for class I MHC antigens. Recognizes a broad spectrum of HLA-A, HLA-B, HLA-C and HLA-G alleles. Involved in the down-regulation of the immune response and the development of tolerance, e.g. towards transplants. Interferes with TNFRSF5- signaling and NF-kappa-B up-regulation. Inhibits receptor-mediated phosphorylation of cellular proteins and mobilization of intracellular calcium ions
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cell membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.4
SNPs LILRB4
Gene Sequence
>1347 bp
ATGATCCCCACCTTCACGGCTCTGCTCTGCCTCGGGCTGAGTCTGGGCCCCAGGACCCAC
ATGCAGGCAGGGCCCCTCCCCAAACCCACCCTCTGGGCTGAGCCAGGCTCTGTGATCAGC
TGGGGGAACTCTGTGACCATCTGGTGTCAGGGGACCCTGGAGGCTCGGGAGTACCGTCTG
GATAAAGAGGAAAGCCCAGCACCCTGGGACAGACAGAACCCACTGGAGCCCAAGAACAAG
GCCAGATTCTCCATCCCATCCATGACAGAGGACTATGCAGGGAGATACCGCTGTTACTAT
CGCAGCCCTGTAGGCTGGTCACAGCCCAGTGACCCCCTGGAGCTGGTGATGACAGGAGCC
TACAGTAAACCCACCCTTTCAGCCCTGCCGAGTCCTCTTGTGACCTCAGGAAAGAGCGTG
ACCCTGCTGTGTCAGTCACGGAGCCCAATGGACACTTTCCTTCTGATCAAGGAGCGGGCA
GCCCATCCCCTACTGCATCTGAGATCAGAGCACGGAGCTCAGCAGCACCAGGCTGAATTC
CCCATGAGTCCTGTGACCTCAGTGCACGGGGGGACCTACAGGTGCTTCAGCTCACACGGC
TTCTCCCACTACCTGCTGTCACACCCCAGTGACCCCCTGGAGCTCATAGTCTCAGGATCC
TTGGAGGATCCCAGGCCCTCACCCACAAGGTCCGTCTCAACAGCTGCAGGCCCTGAGGAC
CAGCCCCTCATGCCTACAGGGTCAGTCCCCCACAGTGGTCTGAGAAGGCACTGGGAGGTA
CTGATCGGGGTCTTGGTGGTCTCCATCCTGCTTCTCTCCCTCCTCCTCTTCCTCCTCCTC
CAACACTGGCGTCAGGGAAAACACAGGACATTGGCCCAGAGACAGGCTGATTTCCAACGT
CCTCCAGGGGCTGCCGAGCCAGAGCCCAAGGACGGGGGCCTACAGAGGAGGTCCAGCCCA
GCTGCTGACGTCCAGGGAGAAAACTTCTGTGCTGCCGTGAAGAACACACAGCCTGAGGAC
GGGGTGGAAATGGACACTCGGCAGAGCCCACACGATGAAGACCCCCAGGCAGTGACGTAT
GCCAAGGTGAAACACTCCAGACCTAGGAGAGAAATGGCCTCTCCTCCCTCCCCACTGTCT
GGGGAATTCCTGGACACAAAGGACAGACAGGCAGAAGAGGACAGACAGATGGACACTGAG
GCTGCTGCATCTGAAGCCCCCCAGGATGTGACCTACGCCCAGCTGCACAGCTTTACCCTC
AGACAGAAGGCAACTGAGCCTCCTCCATCCCAGGAAGGGGCCTCTCCAGCTGAGCCCAGT
GTCTATGCCACTCTGGCCATCCACTAA
Protein Properties
Number of Residues 448
Molecular Weight 49297.1
Theoretical pI 6.76
Pfam Domain Function
Signals
  • 1-21
Transmembrane Regions
  • 260-280
Protein Sequence
>Leukocyte immunoglobulin-like receptor subfamily B member 4
MIPTFTALLCLGLSLGPRTHMQAGPLPKPTLWAEPGSVISWGNSVTIWCQGTLEAREYRL
DKEESPAPWDRQNPLEPKNKARFSIPSMTEDYAGRYRCYYRSPVGWSQPSDPLELVMTGA
YSKPTLSALPSPLVTSGKSVTLLCQSRSPMDTFLLIKERAAHPLLHLRSEHGAQQHQAEF
PMSPVTSVHGGTYRCFSSHGFSHYLLSHPSDPLELIVSGSLEGPRPSPTRSVSTAAGPED
QPLMPTGSVPHSGLRRHWEVLIGVLVVSILLLSLLLFLLLQHWRQGKHRTLAQRQADFQR
PPGAAEPEPKDGGLQRRSSPAADVQGENFCAAVKNTQPEDGVEMDTRQSPHDEDPQAVTY
AKVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMDTEAAASEAPQDVTYAQLHSFTL
RQKATEPPPSQEGASPAEPSVYATLAIH
GenBank ID Protein 125987585
UniProtKB/Swiss-Prot ID Q8NHJ6
UniProtKB/Swiss-Prot Entry Name LIRB4_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_006847.3
GeneCard ID LILRB4
GenAtlas ID LILRB4
HGNC ID HGNC:6608
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  3. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  4. Liu WR, Kim J, Nwankwo C, Ashworth LK, Arm JP: Genomic organization of the human leukocyte immunoglobulin-like receptors within the leukocyte receptor complex on chromosome 19q13.4. Immunogenetics. 2000 Jul;51(8-9):659-69. [PubMed:10941837 ]
  5. Borges L, Hsu ML, Fanger N, Kubin M, Cosman D: A family of human lymphoid and myeloid Ig-like receptors, some of which bind to MHC class I molecules. J Immunol. 1997 Dec 1;159(11):5192-6. [PubMed:9548455 ]
  6. Chang CC, Ciubotariu R, Manavalan JS, Yuan J, Colovai AI, Piazza F, Lederman S, Colonna M, Cortesini R, Dalla-Favera R, Suciu-Foca N: Tolerization of dendritic cells by T(S) cells: the crucial role of inhibitory receptors ILT3 and ILT4. Nat Immunol. 2002 Mar;3(3):237-43. Epub 2002 Jan 28. [PubMed:11875462 ]
  7. Arm JP, Nwankwo C, Austen KF: Molecular identification of a novel family of human Ig superfamily members that possess immunoreceptor tyrosine-based inhibition motifs and homology to the mouse gp49B1 inhibitory receptor. J Immunol. 1997 Sep 1;159(5):2342-9. [PubMed:9278324 ]
  8. Cella M, Dohring C, Samaridis J, Dessing M, Brockhaus M, Lanzavecchia A, Colonna M: A novel inhibitory receptor (ILT3) expressed on monocytes, macrophages, and dendritic cells involved in antigen processing. J Exp Med. 1997 May 19;185(10):1743-51. [PubMed:9151699 ]