You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07798
Secondary Accession Numbers
  • 13507
Name Myosin regulatory light chain 2, atrial isoform
Synonyms
  1. MLC-2a
  2. MLC2a
  3. Myosin light chain 2a
  4. Myosin regulatory light chain 7
Gene Name MYL7
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:7
Locus 7p21-p11.2
SNPs MYL7
Gene Sequence
>528 bp
ATGGCCAGCAGGAAGGCGGGGACCCGGGGCAAGGTGGCAGCCACCAAGCAGGCCCAACGT
GGTTCTTCCAACGTCTTTTCCATGTTTGAACAAGCCCAGATACAGGAGTTCAAAGAAGCC
TTCAGCTGTATCGACCAGAATCGTGATGGCATCATCTGCAAGGCAGACCTGAGGGAGACC
TACTCCCAGCTGGGGAAGGTGAGTGTCCCAGAGGAGGAGCTGGACGCCATGCTGCAAGAG
GGCAAGGGCCCCATCAACTTCACCGTCTTCCTCACGCTCTTTGGGGAGAAGCTCAATGGG
ACAGACCCCGAGGAAGCCATCCTGAGTGCCTTCCGCATGTTTGACCCCAGCGGCAAAGGG
GTGGTGAACAAGGATGAGTTCAAGCAGCTTCTCCTGACCCAGGCAGACAAGTTCTCTCCA
GCTGAGGTGGAGCAGATGTTCGCCCTGACACCCATGGACCTGGCGGGGAACATCGACTAC
AAGTCACTGTGCTACATCATCACCCATGGAGACGAGAAAGAGGAATGA
Protein Properties
Number of Residues 175
Molecular Weight 19447.9
Theoretical pI 4.51
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Myosin regulatory light chain 2, atrial isoform
MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRET
YSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKG
VVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
GenBank ID Protein 189053188
UniProtKB/Swiss-Prot ID Q01449
UniProtKB/Swiss-Prot Entry Name MLRA_HUMAN
PDB IDs Not Available
GenBank Gene ID AK311869
GeneCard ID MYL7
GenAtlas ID MYL7
HGNC ID HGNC:21719
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Hailstones D, Barton P, Chan-Thomas P, Sasse S, Sutherland C, Hardeman E, Gunning P: Differential regulation of the atrial isoforms of the myosin light chains during striated muscle development. J Biol Chem. 1992 Nov 15;267(32):23295-300. [PubMed:1429676 ]