Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07802
Secondary Accession Numbers
  • 13511
Name Stromelysin-3
Synonyms
  1. MMP-11
  2. Matrix metalloproteinase-11
  3. SL-3
  4. ST3
Gene Name MMP11
Protein Type Unknown
Biological Properties
General Function Involved in metalloendopeptidase activity
Specific Function May play an important role in the progression of epithelial malignancies
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region part
extracellular matrix
Function
endopeptidase activity
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
transition metal ion binding
zinc ion binding
metalloendopeptidase activity
peptidase activity
peptidase activity, acting on l-amino acid peptides
metallopeptidase activity
calcium ion binding
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Secreted
  2. extracellular space
  3. extracellular matrix (Probable)
Gene Properties
Chromosome Location Chromosome:2
Locus 22q11.2|22q11.23
SNPs MMP11
Gene Sequence
>1467 bp
ATGGCTCCGGCCGCCTGGCTCCGCAGCGCGGCCGCGCGCGCCCTCCTGCCCCCGATGCTG
CTGCTGCTGCTCCAGCCGCCGCCGCTGCTGGCCCGGGCTCTGCCGCCGGACGTCCACCAC
CTCCATGCCGAGAGGAGGGGGCCACAGCCCTGGCATGCAGCCCTGCCCAGTAGCCCGGCA
CCTGCCCCTGCCACGCAGGAAGCCCCCCGGCCTGCCAGCAGCCTCAGGCCTCCCCGCTGT
GGCGTGCCCGACCCATCTGATGGGCTGAGTGCCCGCAACCGACAGAAGAGGTTCGTGCTT
TCTGGCGGGCGCTGGGAGAAGACGGACCTCACCTACAGGATCCTTCGGTTCCCATGGCAG
TTGGTGCAGGAGCAGGTGCGGCAGACGATGGCAGAGGCCCTAAAGGTATGGAGCGATGTG
ACGCCACTCACCTTTACTGAGGTGCACGAGGGCCGTGCTGACATCATGATCGACTTCGCC
AGGTACTGGCATGGGGACGACCTGCCGTTTGATGGGCCTGGGGGCATCCTGGCCCATGCC
TTCTTCCCCAAGACTCACCGAGAAGGGGATGTCCACTTCGACTATGATGAGACCTGGACT
ATCGGGGATGACCAGGGCACAGACCTGCTGCAGGTGGCAGCCCATGAATTTGGCCACGTG
CTGGGGCTGCAGCACACAACAGCAGCCAAGGCCCTGATGTCCGCCTTCTACACCTTTCGC
TACCCACTGAGTCTCAGCCCAGATGACTGCAGGGGCGTTCAACACCTATATGGCCAGCCC
TGGCCCACTGTCACCTCCAGGACCCCAGCCCTGGGCCCCCAGGCTGGGATAGACACCAAT
GAGATTGCACCGCTGGAGCCAGACGCCCCGCCAGATGCCTGTGAGGCCTCCTTTGACGCG
GTCTCCACCATCCGAGGCGAGCTCTTTTTCTTCAAAGCGGGCTTTGTGTGGCGCCTCCGT
GGGGGCCAGCTGCAGCCCGGCTACCCAGCATTGGCCTCTCGCCACTGGCAGGGACTGCCC
AGCCCTGTGGACGCTGCCTTCGAGGATGCCCAGGGCCACATTTGGTTCTTCCAAGGTGCT
CAGTACTGGGTGTACGACGGTGAAAAGCCAGTCCTGGGCCCCGCACCCCTCACCGAGCTG
GGCCTGGTGAGGTTCCCGGTCCATGCTGCCTTGGTCTGGGGTCCCGAGAAGAACAAGATC
TACTTCTTCCGAGGCAGGGACTACTGGCGTTTCCACCCCAGCACCCGGCGTGTAGACAGT
CCCGTGCCCCGCAGGGCCACTGACTGGAGAGGGGTGCCCTCTGAGATCGACGCTGCCTTC
CAGGATGCTGATGGCTATGCCTACTTCCTGCGCGGCCGCCTCTACTGGAAGTTTGACCCT
GTGAAGGTGAAGGCTCTGGAAGGCTTCCCCCGTCTCGTGGGTCCTGACTTCTTTGGCTGT
GCCGAGCCTGCCAACACTTTCCTCTGA
Protein Properties
Number of Residues 488
Molecular Weight 54617.5
Theoretical pI 6.87
Pfam Domain Function
Signals
  • 1-31
Transmembrane Regions
  • None
Protein Sequence
>Stromelysin-3
MAPAAWLRSAAARALLPPMLLLLLQPPPLLARALPPDVHHLHAERRGPQPWHAALPSSPA
PAPATQEAPRPASSLRPPRCGVPDPSDGLSARNRQKRFVLSGGRWEKTDLTYRILRFPWQ
LVQEQVRQTMAEALKVWSDVTPLTFTEVHEGRADIMIDFARYWHGDDLPFDGPGGILAHA
FFPKTHREGDVHFDYDETWTIGDDQGTDLLQVAAHEFGHVLGLQHTTAAKALMSAFYTFR
YPLSLSPDDCRGVQHLYGQPWPTVTSRTPALGPQAGIDTNEIAPLEPDAPPDACEASFDA
VSTIRGELFFFKAGFVWRLRGGQLQPGYPALASRHWQGLPSPVDAAFEDAQGHIWFFQGA
QYWVYDGEKPVLGPAPLTELGLVRFPVHAALVWGPEKNKIYFFRGRDYWRFHPSTRRVDS
PVPRRATDWRGVPSEIDAAFQDADGYAYFLRGRLYWKFDPVKVKALEGFPRLVGPDFFGC
AEPANTFL
GenBank ID Protein 456257
UniProtKB/Swiss-Prot ID P24347
UniProtKB/Swiss-Prot Entry Name MMP11_HUMAN
PDB IDs
GenBank Gene ID X57766
GeneCard ID MMP11
GenAtlas ID MMP11
HGNC ID HGNC:7157
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  3. Basset P, Bellocq JP, Wolf C, Stoll I, Hutin P, Limacher JM, Podhajcer OL, Chenard MP, Rio MC, Chambon P: A novel metalloproteinase gene specifically expressed in stromal cells of breast carcinomas. Nature. 1990 Dec 20-27;348(6303):699-704. [PubMed:1701851 ]
  4. Anglard P, Melot T, Guerin E, Thomas G, Basset P: Structure and promoter characterization of the human stromelysin-3 gene. J Biol Chem. 1995 Sep 1;270(35):20337-44. [PubMed:7657606 ]
  5. Pei D, Weiss SJ: Furin-dependent intracellular activation of the human stromelysin-3 zymogen. Nature. 1995 May 18;375(6528):244-7. [PubMed:7746327 ]