Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07807
Secondary Accession Numbers
  • 13516
Name Matrix metalloproteinase-19
Synonyms
  1. MMP-18
  2. MMP-19
  3. Matrix metalloproteinase RASI
  4. Matrix metalloproteinase-18
Gene Name MMP19
Protein Type Unknown
Biological Properties
General Function Involved in metalloendopeptidase activity
Specific Function Endopeptidase that degrades various components of the extracellular matrix, such as aggrecan and cartilage oligomeric matrix protein (comp), during development, haemostasis and pathological conditions (arthritic disease). May also play a role in neovascularization or angiogenesis. Hydrolyzes collagen type IV, laminin, nidogen, nascin-C isoform, fibronectin, and type I gelatin
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region part
extracellular matrix
Function
endopeptidase activity
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
transition metal ion binding
zinc ion binding
metalloendopeptidase activity
peptidase activity
peptidase activity, acting on l-amino acid peptides
metallopeptidase activity
calcium ion binding
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Secreted
  2. extracellular space
  3. extracellular matrix
Gene Properties
Chromosome Location Chromosome:1
Locus 12q14
SNPs MMP19
Gene Sequence
>1527 bp
ATGAACTGCCAGCAGCTGTGGCTGGGCTTCCTACTCCCCATGACAGTCTCAGGCCGGGTC
CTGGGGCTTGCAGAGGTGGCGCCCGTGGACTACCTGTCACAATATGGGTACCTACAGAAG
CCTCTAGAAGGATCTAATAACTTCAAGCCAGAAGATATCACCGAGGCTCTGAGAGCTTTT
CAGGAAGCATCTGAACTTCCAGTCTCAGGTCAGCTGGATGATGCCACAAGGGCCCGCATG
AGGCAGCCTCGTTGTGGCCTAGAGGATCCCTTCAACCAGAAGACCCTTAAATACCTGTTG
CTGGGCCGCTGGAGAAAGAAGCACCTGACTTTCCGCATCTTGAACCTGCCCTCCACCCTT
CCACCCCACACAGCCCGGGCAGCCCTGCGTCAAGCCTTCCAGGACTGGAGCAATGTGGCT
CCCTTGACCTTCCAAGAGGTGCAGGCTGGTGCGGCTGACATCCGCCTCTCCTTCCATGGC
CGCCAAAGCTCGTACTGTTCCAATACTTTTGATGGGCCTGGGAGAGTCCTGGCCCATGCC
GACATCCCAGAGCTGGGCAGTGTGCACTTCGACGAAGACGAGTTCTGGACTGAGGGGACC
TACCGTGGGGTGAACCTGCGCATCATTGCAGCCCATGAAGTGGGCCATGCTCTGGGGCTT
GGGCACTCCCGATATTCCCAGGCCCTCATGGCCCCAGTCTACGAGGGCTACCGGCCCCAC
TTTAAGCTGCACCCAGATGATGTGGCAGGGATCCAGGCTCTCTATGGCAAGAAGAGTCCA
GTGATAAGGGATGAGGAAGAAGAAGAGACAGAGCTGCCCACTGTGCCCCCAGTGCCCACA
GAACCCAGTCCCATGCCAGACCCTTGCAGTAGTGAACTGGATGCCATGATGCTGGGGCCC
CGTGGGAAGACCTATGCTTTCAAGGGGGACTATGTGTGGACTGTATCAGATTCAGGACCG
GGCCCCTTGTTCCGAGTGTCTGCCCTTTGGGAGGGGCTCCCCGGAAACCTGGATGCTGCT
GTCTACTCGCCTCGAACACAATGGATTCACTTCTTTAAGGGAGACAAGGTGTGGCGCTAC
ATTAATTTCAAGATGTCTCCTGGCTTCCCCAAGAAGCTGAATAGGTCAGAACCTAACCTG
GATGCAGCTCTCTATTGGCCTCTCAACCAAAAGGTGTTCCTCTTTAAGGGCTCCGGGTAC
TGGCAGTGGGACGAGCTAGCCCGAACTGACTTCAGCAGCTACCCCAAACCAATCAAGGGT
TTGTTTACGGGAGTGCCAAACCAGCCCTCGGCTGCTATGAGTTGGCAAGATGGCCGAGTC
TACTTCTTCAAGGGCAAAGTCTACTGGCGCCTCAACCAGCAGCTTCGAGTAGAGAAAGGC
TATCCCAGAAATATTTCCCACAACTGGATGCACTGTCGTCCCCGGACTATAGACACTACC
CCATCAGGTGGGAATACCACTCCCTCAGGTACGGGCATAACCTTGGATACCACTCTCTCA
GCCACAGAAACCACGTTTGAATACTGA
Protein Properties
Number of Residues 508
Molecular Weight 57356.6
Theoretical pI 7.67
Pfam Domain Function
Signals
  • 1-18
Transmembrane Regions
  • None
Protein Sequence
>Matrix metalloproteinase-19
MNCQQLWLGFLLPMTVSGRVLGLAEVAPVDYLSQYGYLQKPLEGSNNFKPEDITEALRAF
QEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPSTL
PPHTARAALRQAFQDWSNVAPLTFQEVQAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHA
DIPELGSVHFDEDEFWTEGTYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPH
FKLHPDDVAGIQALYGKKSPVIRDEEEEETELPTVPPVPTEPSPMPDPCSSELDAMMLGP
RGKTYAFKGDYVWTVSDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVWRY
INFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKG
LFTGVPNQPSAAMSWQDGRVYFFKGKVYWRLNQQLRVEKGYPRNISHNWMHCRPRTIDTT
PSGGNTTPSGTGITLDTTLSATETTFEY
GenBank ID Protein 1702930
UniProtKB/Swiss-Prot ID Q99542
UniProtKB/Swiss-Prot Entry Name MMP19_HUMAN
PDB IDs Not Available
GenBank Gene ID Y08622
GeneCard ID MMP19
GenAtlas ID MMP19
HGNC ID HGNC:7165
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Stracke JO, Fosang AJ, Last K, Mercuri FA, Pendas AM, Llano E, Perris R, Di Cesare PE, Murphy G, Knauper V: Matrix metalloproteinases 19 and 20 cleave aggrecan and cartilage oligomeric matrix protein (COMP). FEBS Lett. 2000 Jul 28;478(1-2):52-6. [PubMed:10922468 ]
  3. Cossins J, Dudgeon TJ, Catlin G, Gearing AJ, Clements JM: Identification of MMP-18, a putative novel human matrix metalloproteinase. Biochem Biophys Res Commun. 1996 Nov 12;228(2):494-8. [PubMed:8920941 ]
  4. Pendas AM, Knauper V, Puente XS, Llano E, Mattei MG, Apte S, Murphy G, Lopez-Otin C: Identification and characterization of a novel human matrix metalloproteinase with unique structural characteristics, chromosomal location, and tissue distribution. J Biol Chem. 1997 Feb 14;272(7):4281-6. [PubMed:9020145 ]
  5. Kolb C, Mauch S, Peter HH, Krawinkel U, Sedlacek R: The matrix metalloproteinase RASI-1 is expressed in synovial blood vessels of a rheumatoid arthritis patient. Immunol Lett. 1997 Jun 1;57(1-3):83-8. [PubMed:9232430 ]
  6. Sedlacek R, Mauch S, Kolb B, Schatzlein C, Eibel H, Peter HH, Schmitt J, Krawinkel U: Matrix metalloproteinase MMP-19 (RASI-1) is expressed on the surface of activated peripheral blood mononuclear cells and is detected as an autoantigen in rheumatoid arthritis. Immunobiology. 1998 Feb;198(4):408-23. [PubMed:9562866 ]
  7. Stracke JO, Hutton M, Stewart M, Pendas AM, Smith B, Lopez-Otin C, Murphy G, Knauper V: Biochemical characterization of the catalytic domain of human matrix metalloproteinase 19. Evidence for a role as a potent basement membrane degrading enzyme. J Biol Chem. 2000 May 19;275(20):14809-16. [PubMed:10809722 ]