You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07810
Secondary Accession Numbers
  • 13519
Name Matrix metalloproteinase-25
Synonyms
  1. Leukolysin
  2. MMP-25
  3. MT-MMP 6
  4. MT6-MMP
  5. MT6MMP
  6. MTMMP6
  7. Membrane-type matrix metalloproteinase 6
  8. Membrane-type-6 matrix metalloproteinase
Gene Name MMP25
Protein Type Unknown
Biological Properties
General Function Involved in metalloendopeptidase activity
Specific Function May activate progelatinase A
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region part
extracellular matrix
Function
endopeptidase activity
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
transition metal ion binding
zinc ion binding
metalloendopeptidase activity
peptidase activity
peptidase activity, acting on l-amino acid peptides
metallopeptidase activity
calcium ion binding
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Cell membrane
  2. Lipid-anchor
  3. GPI-anchor
  4. Secreted
  5. extracellular space
  6. Extracellular side
  7. extracellular matrix
Gene Properties
Chromosome Location Chromosome:1
Locus 16p13.3
SNPs MMP25
Gene Sequence
>1689 bp
ATGCGGCTGCGGCTCCGGCTTCTGGCGCTGCTGCTTCTGCTGCTGGCACCGCCCGCGCGC
GCCCCGAAGCCCTCGGCGCAGGACGTGAGCCTGGGCGTGGACTGGCTGACTCGCTATGGT
TACCTGCCGCCACCCCACCCTGCCCAGGCCCAGCTGCAGAGCCCTGAGAAGTTGCGCGAT
GCCATCAAAGTCATGCAGAGGTTCGCGGGGCTGCCGGAGACCGGCCGCATGGACCCAGGG
ACAGTGGCCACCATGCGTAAGCCCCGCTGCTCCCTGCCTGACGTGCTGGGGGTGGCGGGG
CTGGTCAGGCGGCGTCGCCGGTACGCTCTGAGCGGCAGCGTGTGGAAGAAGCGAACCCTG
ACATGGAGGGTACGTTCCTTCCCCCAGAGCTCCCAGCTGAGCCAGGAGACCGTGCGGGTC
CTCATGAGCTATGCCCTGATGGCCTGGGGCATGGAGTCAGGCCTCACATTTCATGAGGTG
GATTCCCCCCAGGGCCAGGAGCCCGACATCCTCATCGACTTTGCCCGCGCCTTCCACCAG
GACAGCTACCCCTTCGACGGGTTGGGGGGCACCCTAGCCCATGCCTTCTTCCCTGGGGAG
CACCCCATCTCCGGGGACACTCACTTTGACGATGAGGAGACCTGGACTTTTGGGTCAAAA
GACGGCGAGGGGACCGACCTGTTTGCCGTGGCTGTCCATGAGTTTGGCCACGCCCTGGGC
CTGGGCCACTCCTCAGCCCCCAACTCCATTATGAGGCCCTTCTACCAGGGTCCGGTGGGC
GACCCTGACAAGTACCGCCTGTCTCAGGATGACCGCGATGGCCTGCAGCAACTCTATGGG
AAGGCGCCCCAAACCCCATATGACAAGCCCACAAGGAAACCCCTGGCTCCTCCGCCCCAG
CCCCCGGCCTCGCCCACACACAGCCCATCCTTCCCCATCCCTGATCGATGTGAGGGCAAT
TTTGACGCCATCGCCAACATCCGAGGGGAAACTTTCTTCTTCAAAGGCCCCTGGTTCTGG
CGCCTCCAGCCCTCCGGACAGCTGGTGTCCCCGCGACCCGCACGGCTGCACCGCTTCTGG
GAGGGGCTGCCCGCCCAGGTGAGGGTGGTGCAGGCCGCCTATGCTCGGCACCGAGACGGC
CGAATCCTCCTCTTTAGCGGGCCCCAGTTCTGGGTGTTCCAGGACCGGCAGCTGGAGGGC
GGGGCGCGGCCGCTCACGGAGCTGGGGCTGCCCCCGGGAGAGGAGGTGGACGCCGTGTTC
TCGTGGCCACAGAACGGGAAGACCTACCTGGTCCGCGGCCGGCAGTACTGGCGCTACGAC
GAGGCGGCGGCGCGCCCGGACCCCGGCTACCCTCGCGACCTGAGCCTCTGGGAAGGCGCG
CCCCCCTCCCCTGACGATGTCACCGTCAGCAACGCAGGTGACACCTACTTCTTCAAGGGC
GCCCACTACTGGCGCTTCCCCAAGAACAGCATCAAGACCGAGCCGGACGCCCCCCAGCCC
ATGGGGCCCAACTGGCTGGACTGCCCCGCCCCGAGCTCTGGTCCCCGCGCCCCCAGGCCC
CCCAAAGCGACCCCCGTGTCCGAAACCTGCGATTGTCAGTGCGAGCTCAACCAGGCCGCA
GGACGTTGGCCTGCTCCCATCCCGCTGCTCCTCTTGCCCCTGCTGGTGGGGGGTGTAGCC
TCCCGCTGA
Protein Properties
Number of Residues 562
Molecular Weight 62553.4
Theoretical pI 8.72
Pfam Domain Function
Signals
  • 1-21
Transmembrane Regions
  • None
Protein Sequence
>Matrix metalloproteinase-25
MRLRLRLLALLLLLLAPPARAPKPSAQDVSLGVDWLTRYGYLPPPHPAQAQLQSPEKLRD
AIKVMQRFAGLPETGRMDPGTVATMRKPRCSLPDVLGVAGLVRRRRRYALSGSVWKKRTL
TWRVRSFPQSSQLSQETVRVLMSYALMAWGMESGLTFHEVDSPQGQEPDILIDFARAFHQ
DSYPFDGLGGTLAHAFFPGEHPISGDTHFDDEETWTFGSKDGEGTDLFAVAVHEFGHALG
LGHSSAPNSIMRPFYQGPVGDPDKYRLSQDDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQ
PPASPTHSPSFPIPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFW
EGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLEGGARPLTELGLPPGEEVDAVF
SWPQNGKTYLVRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTVSNAGDTYFFKG
AHYWRFPKNSIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPKATPVSETCDCQCELNQAA
GRWPAPIPLLLLPLLVGGVASR
GenBank ID Protein 8546817
UniProtKB/Swiss-Prot ID Q9NPA2
UniProtKB/Swiss-Prot Entry Name MMP25_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ239053
GeneCard ID MMP25
GenAtlas ID MMP25
HGNC ID HGNC:14246
References
General References
  1. Velasco G, Cal S, Merlos-Suarez A, Ferrando AA, Alvarez S, Nakano A, Arribas J, Lopez-Otin C: Human MT6-matrix metalloproteinase: identification, progelatinase A activation, and expression in brain tumors. Cancer Res. 2000 Feb 15;60(4):877-82. [PubMed:10706098 ]
  2. Pei D: Leukolysin/MMP25/MT6-MMP: a novel matrix metalloproteinase specifically expressed in the leukocyte lineage. Cell Res. 1999 Dec;9(4):291-303. [PubMed:10628838 ]
  3. Kojima S, Itoh Y, Matsumoto S, Masuho Y, Seiki M: Membrane-type 6 matrix metalloproteinase (MT6-MMP, MMP-25) is the second glycosyl-phosphatidyl inositol (GPI)-anchored MMP. FEBS Lett. 2000 Sep 1;480(2-3):142-6. [PubMed:11034316 ]