Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07823
Secondary Accession Numbers
  • 13532
Name Myosin light chain 5
Synonyms
  1. MYLC2
  2. MyLC-2
  3. Myosin regulatory light chain 5
  4. Superfast myosin regulatory light chain 2
Gene Name MYL5
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:4
Locus 4p16.3
SNPs MYL5
Gene Sequence
>522 bp
ATGGCCAGCAGGAAGACCAAGAAGAAGGAAGGGGGTGCCCTCCGGGCCCAGAGAGCCTCA
TCCAATGTCTTCTCCAACTTTGAGCAGACTCAGATCCAGGAGTTCAAGGAGGCATTCACA
CTCATGGATCAGAACCGAGATGGCTTCATTGACAAGGAGGACCTGAAGGACACCTATGCC
TCCCTGGGCAAGACCAACGTCAAGGACGACGAGCTGGACGCCATGCTCAAAGAGGCCTCG
GGGCCCATCAACTTCACCATGTTTCTGAACCTGTTTGGGGAGAAGCTGAGCGGTACCGAC
GCCGAGGAGACCATTCTTAACGCCTTCAAGATGCTGGACCCGGACGGGAAAGGGAAAATC
AACAAGGAGTACATCAAGCGTCTGCTGATGTCCCAGGCTGACAAGATGACGGCGGAAGAG
GTGGACCAGATGTTCCAGTTCGCCTCCATCGATGTGGCGGGCAACCTGGACTACAAGGCG
CTCAGCTACGTGATCACCCACGGGGAGGAGAAGGAGGAGTGA
Protein Properties
Number of Residues 173
Molecular Weight 19533.8
Theoretical pI 4.57
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Myosin light chain 5
MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYA
SLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKI
NKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE
GenBank ID Protein 4505305
UniProtKB/Swiss-Prot ID Q02045
UniProtKB/Swiss-Prot Entry Name MYL5_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_002477.1
GeneCard ID MYL5
GenAtlas ID MYL5
HGNC ID HGNC:7586
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Collins C, Schappert K, Hayden MR: The genomic organization of a novel regulatory myosin light chain gene (MYL5) that maps to chromosome 4p16.3 and shows different patterns of expression between primates. Hum Mol Genet. 1992 Dec;1(9):727-33. [PubMed:1284596 ]