You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07825
Secondary Accession Numbers
  • 13534
Name Myosin light chain 6B
Synonyms
  1. MLC1sa
  2. Myosin light chain 1 slow-twitch muscle A isoform
  3. Smooth muscle and nonmuscle myosin light chain alkali 6B
Gene Name MYL6B
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Regulatory light chain of myosin. Does not bind calcium
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 12q13.13
SNPs MYL6B
Gene Sequence
>627 bp
ATGCCTCCCAAGAAGGATGTTCCCGTGAAGAAACCAGCAGGGCCCTCCATCTCCAAACCT
GCTGCTAAGCCAGCAGCAGCAGGGGCTCCTCCAGCCAAGACCAAAGCTGAGCCAGCTGTC
CCCCAGGCCCCTCAGAAAACCCAGGAGCCTCCAGTCGATCTCTCCAAAGTGGTGATCGAG
TTTAACAAGGACCAGCTGGAGGAGTTCAAGGAGGCCTTCGAGCTGTTTGACCGAGTGGGG
GATGGCAAGATCCTGTACAGCCAGTGTGGGGACGTGATGAGGGCCCTGGGCCAGAACCCC
ACCAACGCCGAGGTGCTCAAGGTCCTGGGGAACCCCAAGAGTGATGAGCTGAAGTCGCGG
CGTGTGGACTTTGAGACTTTCCTGCCCATGCTCCAGGCAGTGGCCAAGAACCGAGGCCAA
GGCACATATGAGGACTACTTGGAGGGGTTTCGTGTGTTTGACAAGGAGGGGAACGGCAAA
GTCATGGGAGCAGAGCTCAGACATGTTCTCACCACCCTTGGAGAGAAGATGACTGAGGAG
GAGGTGGAGACCGTTCTGGCAGGACACGAGGACAGCAACGGCTGCATCAACTACGAGGCC
TTCTTGAAACACATCCTAAGCGTTTGA
Protein Properties
Number of Residues 208
Molecular Weight 22763.9
Theoretical pI 5.44
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Myosin light chain 6B
MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIE
FNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSR
RVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEE
EVETVLAGHEDSNGCINYEAFLKHILSV
GenBank ID Protein 15214600
UniProtKB/Swiss-Prot ID P14649
UniProtKB/Swiss-Prot Entry Name MYL6B_HUMAN
PDB IDs
GenBank Gene ID BC012425
GeneCard ID MYL6B
GenAtlas ID MYL6B
HGNC ID HGNC:29823
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Hailstones DL, Gunning PW: Characterization of human myosin light chains 1sa and 3nm: implications for isoform evolution and function. Mol Cell Biol. 1990 Mar;10(3):1095-104. [PubMed:2304459 ]
  3. Zimmermann K, Starzinski-Powitz A: A novel isoform of myosin alkali light chain isolated from human muscle cells. Nucleic Acids Res. 1989 Dec 25;17(24):10496. [PubMed:2602161 ]