Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07826
Secondary Accession Numbers
  • 13535
Name Myosin regulatory light polypeptide 9
Synonyms
  1. 20 kDa myosin light chain
  2. LC20
  3. MLC-2C
  4. Myosin RLC
  5. Myosin regulatory light chain 2, smooth muscle isoform
  6. Myosin regulatory light chain 9
  7. Myosin regulatory light chain MRLC1
Gene Name MYL9
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:2
Locus 20q11.23
SNPs MYL9
Gene Sequence
>519 bp
ATGTCCAGCAAGCGGGCCAAAGCCAAGACCACCAAGAAGCGGCCACAGCGGGCCACATCC
AATGTCTTCGCAATGTTTGACCAGTCCCAGATCCAGGAGTTTAAGGAGGCTTTCAACATG
ATTGACCAGAACCGTGATGGCTTCATTGACAAGGAGGACCTGCACGACATGCTGGCCTCG
CTGGGGAAGAACCCCACAGACGAATACCTGGAGGGCATGATGAGCGAGGCCCCGGGGCCC
ATCAACTTCACCATGTTCCTCACCATGTTTGGGGAGAAGCTGAACGGCACGGACCCCGAG
GATGTGATTCGCAACGCCTTTGCCTGCTTCGACGAGGAAGCCTCAGGTTTCATCCATGAG
GACCACCTCCGGGAGCTGCTCACCACCATGGGTGACCGCTTCACAGATGAGGAAGTGGAC
GAGATGTACCGGGAGGCACCCATTGATAAGAAAGGCAACTTCAACTACGTGGAGTTCACC
CGCATCCTCAAACATGGCGCCAAGGATAAAGACGACTAG
Protein Properties
Number of Residues 172
Molecular Weight 19827.0
Theoretical pI 4.54
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Myosin regulatory light polypeptide 9
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
GenBank ID Protein 6983729
UniProtKB/Swiss-Prot ID P24844
UniProtKB/Swiss-Prot Entry Name MYL9_HUMAN
PDB IDs Not Available
GenBank Gene ID AL050318
GeneCard ID MYL9
GenAtlas ID MYL9
HGNC ID HGNC:15754
References
General References
  1. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  2. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052 ]
  3. Molina H, Horn DM, Tang N, Mathivanan S, Pandey A: Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry. Proc Natl Acad Sci U S A. 2007 Feb 13;104(7):2199-204. Epub 2007 Feb 7. [PubMed:17287340 ]
  4. Iwasaki T, Murata-Hori M, Ishitobi S, Hosoya H: Diphosphorylated MRLC is required for organization of stress fibers in interphase cells and the contractile ring in dividing cells. Cell Struct Funct. 2001 Dec;26(6):677-83. [PubMed:11942626 ]
  5. Kumar CC, Mohan SR, Zavodny PJ, Narula SK, Leibowitz PJ: Characterization and differential expression of human vascular smooth muscle myosin light chain 2 isoform in nonmuscle cells. Biochemistry. 1989 May 2;28(9):4027-35. [PubMed:2526655 ]