Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07827
Secondary Accession Numbers
  • 13536
Name Myosin regulatory light chain 10
Synonyms
  1. Myosin light chain 2, lymphocyte-specific
  2. Precursor lymphocyte-specific regulatory light chain
Gene Name MYL10
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:7
Locus 7q22.1
SNPs MYL10
Gene Sequence
>681 bp
ATGTTGCTTAGGCTGGTCTCAAACTCCTGGCCTCAAGTGATCCTCCCTCCTCGGCCTCCC
AAAGTGCTGGGATTACAGGCACCGAGAAGAGCTCGGAAAAGAGCAGAAGGCACCGCCAGC
TCCAACGTCTTCTCCATGTTTGATCAGTCCCAGATCCAGGAGTTTAAAGAGAGTCTGGCT
CTGTCGCCCAGGCTGGAGCGCAATGGCATGATCTCGGCTCACTGCAACCTCTGCCTCACG
GGTTCAAGCAATTCTCCTGCCTCAGCCTCCCAAGCTTTCACCATCATGGACCAGAACCGT
GATGGCTTCATCGACAAAGAGGACTTGAGGGACACCTTTGCCGCGCTGGGCCGCATCAAT
GTCAAGAACGAGGAACTGGAGGCCATGGTGAAGGAGGCCCCCGGACCCATCAACTTCACG
GTGTTCCTGACCATGTTTGGGGAGAAGCTGAAGGGCACGGACCCAGAGGAGACCATTCTC
CACGCCTTCAAAGTGTTCGACACTGAAGGGAAAGGTTTCGTCAAGGCCGATGTCATCAAA
GAAAAACTTATGACCCAGGCAGACCGCTTCAGTGAGGAGGAGGTCAAGCAGATGTTTGCA
GCGTTTCCCCCAGATGTGTGCGGCAACCTGGACTACAGAAACCTGTGCTACGTCATCACT
CACGGTGAAGAGAAGGATTAG
Protein Properties
Number of Residues 226
Molecular Weight 25307.7
Theoretical pI 5.43
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Myosin regulatory light chain 10
MLLRLVSNSWPQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLA
LSPRLERNGMISAHCNLCLTGSSNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRIN
VKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIK
EKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD
GenBank ID Protein 33877163
UniProtKB/Swiss-Prot ID Q9BUA6
UniProtKB/Swiss-Prot Entry Name MYL10_HUMAN
PDB IDs Not Available
GenBank Gene ID BC002778
GeneCard ID MYL10
GenAtlas ID MYL10
HGNC ID HGNC:29825
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]