You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07828
Secondary Accession Numbers
  • 13537
Name Myosin-VI
Synonyms
  1. Unconventional myosin-6
Gene Name MYO6
Protein Type Unknown
Biological Properties
General Function Involved in motor activity
Specific Function Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Myosin 6 is a reverse-direction motor protein that moves towards the minus-end of actin filaments. Has slow rate of actin-activated ADP release due to weak ATP binding. Functions in a variety of intracellular processes such as vesicular membrane trafficking and cell migration. Required for the structural integrity of the Golgi apparatus via the p53-dependent pro-survival pathway. Appears to be involved in a very early step of clathrin-mediated endocytosis in polarized epithelial cells. May act as a regulator of F-actin dynamics. May play a role in transporting DAB2 from the plasma membrane to specific cellular targets. Required for structural integrity of inner ear hair cells
Pathways Not Available
Reactions Not Available
GO Classification
Component
myosin complex
macromolecular complex
protein complex
Function
binding
catalytic activity
hydrolase activity
motor activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Cellular Location
  1. Cell projection
  2. ruffle membrane
  3. Isoform 4:Cytoplasmic vesicle
  4. clathrin- coated vesicle membrane
Gene Properties
Chromosome Location Chromosome:6
Locus 6q13
SNPs MYO6
Gene Sequence
>3858 bp
ATGGAGGATGGAAAGCCCGTTTGGGCGCCACACCCTACAGATGGATTTCAGATGGGCAAT
ATTGTGGATATTGGCCCCGACAGCTTAACAATTGAACCCTTGAATCAGAAAGGCAAGACA
TTTTTGGCTCTCATAAACCAAGTGTTTCCTGCAGAAGAGGACAGTAAAAAAGATGTGGAA
GATAACTGTTCACTAATGTATTTAAATGAAGCCACACTGCTCCATAATATCAAAGTTCGA
TATAGTAAAGACAGAATTTATACATATGTCGCCAACATTCTGATTGCAGTGAATCCATAC
TTTGACATACCTAAAATATATTCTTCAGAAGCAATAAAGTCATATCAAGGAAAATCTCTT
GGGACAAGACCACCTCATGTCTTTGCAATTGCTGATAAAGCTTTTCGAGACATGAAGGTG
CTCAAGATGAGTCAGTCTATCATTGTATCTGGAGAATCAGGAGCCGGCAAAACAGAAAAT
ACAAAATTTGTTCTAAGATACCTGACTGAATCCTATGGAACAGGTCAAGATATTGATGAC
AGAATTGTTGAAGCTAACCCACTCCTAGAAGCCTTTGGAAATGCGAAGACTGTTCGCAAC
AATAATAGCAGTCGATTTGGGAAATTTGTAGAAATACATTTTAATGAAAAGAGCTCAGTT
GTTGGAGGATTTGTTTCACATTATCTCCTAGAGAAATCTAGGATCTGTGTTCAAGGCAAA
GAGGAAAGAAATTATCATATCTTTTATAGGTTGTGTGCTGGTGCTTCTGAAGATATTAGA
GAAAAACTTCATTTGAGTTCACCAGATAATTTTCGGTATTTAAACCGAGGCTGCACTAGA
TACTTTGCTAACAAAGAAACTGACAAACAGATTTTACAGAACCGCAAAAGTCCTGAGTAC
CTTAAGGCAGGTTCTATGAAAGATCCTCTGCTAGATGACCATGGTGATTTTATTAGAATG
TGCACGGCTATGAAAAAAATTGGTTTGGATGATGAAGAAAAGCTTGATCTCTTCCGGGTA
GTAGCTGGCGTCCTGCACCTTGGAAATATTGATTTTGAGGAAGCTGGCAGCACTTCAGGT
GGTTGTAATCTGAAGAATAAATCTGCTCAGTCTTTGGAATATTGTGCTGAATTACTGGGT
TTGGACCAAGATGATCTTCGAGTAAGTTTGACCACAAGAGTCATGCTAACAACAGCAGGG
GGCACCAAAGGAACAGTTATAAAGGTACCTCTGAAAGTGGAGCAAGCAAACAATGCTCGT
GATGCCCTGGCAAAGACAGTGTATAGCCATCTTTTTGATCATGTGGTAAACAGAGTAAAT
CAGTGTTTTCCTTTTGAAACATCATCCTATTTTATTGGAGTCCTAGATATTGCTGGTTTT
GAGTACTTTGAGCATAACAGTTTTGAACAATTTTGCATCAACTATTGCAATGAAAAACTT
CAACAATTTTTTAATGAAAGGATTCTGAAGGAGGAACAAGAACTCTATCAAAAAGAAGGT
TTAGGTGTTAATGAAGTGCATTATGTGGATAATCAGGACTGTATAGATTTAATTGAAGCC
AAATTAGTGGGAATACTGGATATTTTGGATGAAGAAAATCGCCTTCCCCAGCCAAGTGAT
CAACACTTTACATCTGCAGTTCACCAAAAGCACAAGGATCATTTTCGACTCACTATTCCC
AGAAAATCTAAGCTGGCAGTTCATAGGAATATCAGAGACGACGAAGGCTTCATTATCAGG
CATTTTGCGGGGGCAGTGTGCTATGAAACAACCCAGTTTGTGGAGAAAAATAATGATGCT
TTACATATGTCTCTTGAATCCTTAATATGTGAATCCAGAGATAAGTTTATACGGGAATTA
TTTGAATCATCCACAAATAACAACAAAGATACTAAACAAAAAGCAGGAAAACTTAGCTTC
ATCAGCGTGGGAAACAAGTTTAAGACACAGTTAAATTTGCTTCTGGATAAACTTCGAAGT
ACTGGAGCAAGCTTTATTCGTTGCATCAAACCTAACTTAAAGATGACAAGCCACCACTTT
GAAGGTGCTCAAATTCTGTCTCAGCTTCAGTGTTCAGGGATGGTGTCTGTTTTGGACTTG
ATGCAGGGTGGTTACCCATCACGAGCTTCATTTCATGAACTCTACAACATGTACAAAAAG
TATATGCCAGATAAACTTGCAAGATTGGATCCAAGACTATTTTGTAAGGCTTTGTTTAAA
GCTTTGGGCTTAAATGAAAATGACTACAAGTTTGGGTTAACCAAAGTATTTTTTAGACCT
GGCAAGTTTGCAGAATTTGATCAGATCATGAAGTCTGACCCTGACCACTTAGCAGAGTTG
GTTAAAAGAGTCAATCACTGGCTCACATGCAGTCGCTGGAAGAAAGTTCAGTGGTGCTCA
CTCTCAGTCATCAAATTGAAAAACAAAATAAAATATCGAGCTGAAGCCTGCATTAAAATG
CAAAAAACTATTCGAATGTGGCTTTGCAAGAGGAGACACAAACCTCGCATTGATGGTCTG
GTTAAGGTGGGCACACTGAAAAAACGACTTGATAAATTTAATGAGGTAGTCAGTGTGTTG
AAAGATGGAAAACCCGAGATGAATAAACAGATCAAGAATCTGGAAATTTCTATTGATACT
TTGATGGCCAAAATTAAGTCCACTATGATGACGCAGGAACAAATCCAGAAAGAATATGAT
GCACTGGTTAAAAGCTCAGAGGAACTCCTCAGTGCATTACAGAAAAAAAAACAGCAGGAA
GAGGAAGCAGAAAGGCTGAGGCGTATTCAAGAAGAAATGGAAAAGGAAAGAAAAAGACGT
GAAGAAGACGAAAAACGTCGAAGAAAGGAAGAGGAGGAAAGGCGGATGAAACTTGAGATG
GAAGCAAAGAGAAAACAAGAAGAAGAAGAGAGAAAGAAAAGGGAAGATGATGAAAAACGC
ATTCAAGCTGAAGTGGAGGCACAGCTGGCCCGACAGAAGGAGGAGGAATCCCAACAGCAA
GCAGTTCTGGAGCAGGAGCGCAGGGACCGGGAGCTGGCCCTGAGGATTGCCCAGAGTGAA
GCCGAGCTCATCAGTGATGAGGCCCAGGCCGACCTGGCGCTGCGGAGAAATGATGGAACA
AGACCCAAAATGACACCGGAACAAATGGCCAAAGAAATGTCAGAATTTTTGAGTAGAGGT
CCTGCTGTACTAGCCACCAAAGCAGCTGCTGGTACTAAGAAATATGATCTTAGTAAATGG
AAATATGCAGAACTACGTGATACCATCAATACTTCTTGTGATATTGAGCTCCTGGCAGCT
TGCAGAGAAGAATTTCATAGGAGACTAAAAGTGTATCATGCTTGGAAATCTAAGAACAAG
AAGAGAAATACTGAAACAGAGCAACGTGCTCCAAAGTCTGTTACTGATTATGATTTTGCA
CCATTTTTGAACAATTCACCTCAGCAAAACCCAGCAGCTCAGATTCCTGCCAGGCAGCGG
GAGATTGAAATGAACCGACAGCAACGCTTCTTCCGCATCCCATTCATCCGCCCTGCCGAC
CAGTACAAAGACCCTCAGAGTAAGAAAAAAGGCTGGTGGTATGCCCATTTTGATGGACCA
TGGATTGCCCGGCAAATGGAACTCCATCCTGACAAGCCACCCATCCTACTTGTGGCTGGT
AAGGACGACATGGAGATGTGTGAGCTGAATCTTGAGGAGACTGGCCTGACTCGGAAGCGT
GGTGCTGAGATCTTGCCAAGACAGTTTGAAGAAATCTGGGAACGCTGTGGAGGCATCCAG
TACCTTCAGAATGCGATTGAGAGCAGACAGGCTCGGCCCACCTATGCAACAGCCATGCTG
CAGAGTCTGTTAAAGTAG
Protein Properties
Number of Residues 1294
Molecular Weight 149689.8
Theoretical pI 8.72
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Myosin-VI
MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVE
DNCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSEAIKSYQGKSL
GTRPPHVFAIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDD
RIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGK
EERNYHIFYRLCAGASEDIREKLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEY
LKAGSMKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSG
GCNLKNKSAQSLEYCAELLGLDQDDLRVSLTTRVMLTTAGGTKGTVIKVPLKVEQANNAR
DALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKL
QQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEAKLVGILDILDEENRLPQPSD
QHFTSAVHQKHKDHFRLTIPRKSKLAVHRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDA
LHMSLESLICESRDKFIRELFESSTNNNKDTKQKAGKLSFISVGNKFKTQLNLLLDKLRS
TGASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDLMQGGYPSRASFHELYNMYKK
YMPDKLARLDPRLFCKALFKALGLNENDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAEL
VKRVNHWLTCSRWKKVQWCSLSVIKLKNKIKYRAEACIKMQKTIRMWLCKRRHKPRIDGL
VKVGTLKKRLDKFNEVVSVLKDGKPEMNKQIKNLEISIDTLMAKIKSTMMTQEQIQKEYD
ALVKSSEELLSALQKKKQQEEEAERLRRIQEEMEKERKRREEDEKRRRKEEEERRMKLEM
EAKRKQEEEERKKREDDEKRIQAEVEAQLARQKEEESQQQAVLEQERRDRELALRIAQSE
AELISDEAQADLALRRSLDSYPVSKNDGTRPKMTPEQMAKEMSEFLSRGPAVLATKAAAG
TKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTETEQRAP
KSVTDYDFAPFLNNSPQQNPAAQIPARQREIEMNRQQRFFRIPFIRPADQYKDPQSKKKG
WWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEE
IWERCGGIQYLQNAIESRQARPTYATAMLQSLLK
GenBank ID Protein 92859701
UniProtKB/Swiss-Prot ID Q9UM54
UniProtKB/Swiss-Prot Entry Name MYO6_HUMAN
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID MYO6
GenAtlas ID MYO6
HGNC ID HGNC:7605
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Wolf-Yadlin A, Hautaniemi S, Lauffenburger DA, White FM: Multiple reaction monitoring for robust quantitative proteomic analysis of cellular signaling networks. Proc Natl Acad Sci U S A. 2007 Apr 3;104(14):5860-5. Epub 2007 Mar 26. [PubMed:17389395 ]
  4. Nagase T, Ishikawa K, Nakajima D, Ohira M, Seki N, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1997 Apr 28;4(2):141-50. [PubMed:9205841 ]
  5. Swiatecka-Urban A, Boyd C, Coutermarsh B, Karlson KH, Barnaby R, Aschenbrenner L, Langford GM, Hasson T, Stanton BA: Myosin VI regulates endocytosis of the cystic fibrosis transmembrane conductance regulator. J Biol Chem. 2004 Sep 3;279(36):38025-31. Epub 2004 Jul 9. [PubMed:15247260 ]
  6. Avraham KB, Hasson T, Sobe T, Balsara B, Testa JR, Skvorak AB, Morton CC, Copeland NG, Jenkins NA: Characterization of unconventional MYO6, the human homologue of the gene responsible for deafness in Snell's waltzer mice. Hum Mol Genet. 1997 Aug;6(8):1225-31. [PubMed:9259267 ]
  7. Wells AL, Lin AW, Chen LQ, Safer D, Cain SM, Hasson T, Carragher BO, Milligan RA, Sweeney HL: Myosin VI is an actin-based motor that moves backwards. Nature. 1999 Sep 30;401(6752):505-8. [PubMed:10519557 ]
  8. Buss F, Arden SD, Lindsay M, Luzio JP, Kendrick-Jones J: Myosin VI isoform localized to clathrin-coated vesicles with a role in clathrin-mediated endocytosis. EMBO J. 2001 Jul 16;20(14):3676-84. [PubMed:11447109 ]
  9. Morris SM, Arden SD, Roberts RC, Kendrick-Jones J, Cooper JA, Luzio JP, Buss F: Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. Traffic. 2002 May;3(5):331-41. [PubMed:11967127 ]
  10. Lister I, Schmitz S, Walker M, Trinick J, Buss F, Veigel C, Kendrick-Jones J: A monomeric myosin VI with a large working stroke. EMBO J. 2004 Apr 21;23(8):1729-38. Epub 2004 Mar 25. [PubMed:15044955 ]
  11. Vreugde S, Ferrai C, Miluzio A, Hauben E, Marchisio PC, Crippa MP, Bussi M, Biffo S: Nuclear myosin VI enhances RNA polymerase II-dependent transcription. Mol Cell. 2006 Sep 1;23(5):749-55. [PubMed:16949370 ]
  12. Jung EJ, Liu G, Zhou W, Chen X: Myosin VI is a mediator of the p53-dependent cell survival pathway. Mol Cell Biol. 2006 Mar;26(6):2175-86. [PubMed:16507995 ]
  13. Melchionda S, Ahituv N, Bisceglia L, Sobe T, Glaser F, Rabionet R, Arbones ML, Notarangelo A, Di Iorio E, Carella M, Zelante L, Estivill X, Avraham KB, Gasparini P: MYO6, the human homologue of the gene responsible for deafness in Snell's waltzer mice, is mutated in autosomal dominant nonsyndromic hearing loss. Am J Hum Genet. 2001 Sep;69(3):635-40. Epub 2001 Jul 20. [PubMed:11468689 ]
  14. Ahmed ZM, Morell RJ, Riazuddin S, Gropman A, Shaukat S, Ahmad MM, Mohiddin SA, Fananapazir L, Caruso RC, Husnain T, Khan SN, Riazuddin S, Griffith AJ, Friedman TB, Wilcox ER: Mutations of MYO6 are associated with recessive deafness, DFNB37. Am J Hum Genet. 2003 May;72(5):1315-22. Epub 2003 Apr 8. [PubMed:12687499 ]
  15. Mohiddin SA, Ahmed ZM, Griffith AJ, Tripodi D, Friedman TB, Fananapazir L, Morell RJ: Novel association of hypertrophic cardiomyopathy, sensorineural deafness, and a mutation in unconventional myosin VI (MYO6). J Med Genet. 2004 Apr;41(4):309-14. [PubMed:15060111 ]