You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07829
Secondary Accession Numbers
  • 13538
Name Myosin-IXb
Synonyms
  1. Unconventional myosin-9b
Gene Name MYO9B
Protein Type Unknown
Biological Properties
General Function Involved in motor activity
Specific Function Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. May be involved in the remodeling of the actin cytoskeleton. Binds actin with high affinity both in the absence and presence of ATP and its mechanochemical activity is inhibited by calcium ions. Also acts as a GTPase activating protein on Rho
Pathways Not Available
Reactions Not Available
GO Classification
Component
myosin complex
cell part
macromolecular complex
protein complex
intracellular
Function
binding
catalytic activity
hydrolase activity
motor activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signaling pathway
signaling
signaling pathway
Cellular Location
  1. Cytoplasm
  2. Cytoplasm
  3. Cytoplasm
  4. perinuclear region
  5. cytoskeleton
  6. cell cortex
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.1
SNPs MYO9B
Gene Sequence
>6474 bp
ATGAGTGTGAAAGAGGCAGGCAGCTCGGGCCGCCGGGAGCAGGCGGCCTACCACCTGCAC
ATCTACCCCCAGCTGTCCACCACCGAGAGCCAGGCCTCGTGCCGCGTGACTGCCACCAAG
GACAGCACCACCTCGGACGTCATCAAGGACGCCATTGCCAGCCTGCGGCTGGACGGCACC
AAATGTTATGTGCTGGTGGAGGTCAAAGAGTCGGGAGGCGAGGAATGGGTGCTGGACGCC
AACGACTCGCCTGTGCACCGGGTGCTGCTATGGCCCCGGCGGGCACAGGACGAGCACCCT
CAGGAGGATGGCTACTACTTCCTGCTGCAGGAGCGCAACGCAGATGGAACCATCAAGTAC
GTGCATATGCAGCTGGTGGCGCAGGCCACAGCCACCCGGCGCCTAGTGGAGCGTGGCCTC
CTGCCACGGCAGCAGGCGGACTTTGATGACCTGTGTAACCTCCCCGAGCTAACCGAGGGC
AACCTCCTGAAGAACCTCAAGCACCGCTTCCTGCAACAAAAGATCTACACGTACGCGGGG
AGCATCCTGGTGGCCATCAACCCCTTTAAGTTCCTGCCCATCTACAACCCCAAGTACGTG
AAGATGTATGAGAACCAGCAGCTGGGCAAGCTGGAGCCACACGTCTTCGCGCTGGCCGAC
GTGGCCTACTACACCATGCTCAGGAAGCGCGTGAACCAGTGCATCGTGATCTCGGGTGAG
AGCGGCTCCGGCAAGACCCAGAGCACCAACTTCCTCATCCACTGCCTCACCGCCCTCAGC
CAGAAGGGCTACGCCAGCGGCGTCGAGAGGACCATCCTGGGTGCTGGCCCTGTGCTGGAG
GCTTTTGGAAATGCCAAGACAGCCCACAACAACAACTCCAGCCGGTTTGGGAAATTCATC
CAAGTCAGCTACCTAGAGAGTGGCATCGTGAGAGGAGCTGTCGTCGAGAAATATCTGCTT
GAAAAGTCTCGCCTGGTGTCTCAGGAGAAGGATGAGAGGAACTACCATGTGTTTTATTAT
TTGTTACTTGGGGTCAGCGAGGAAGAGCGCCAAGAATTTCAGCTCAAGCAGCCTGAAGAT
TATTTCTACCTCAACCAGCATAACTTGAAGATTGAAGATGGGGAGGACCTGAAGCATGAC
TTTGAGAGGCTCAAGCAGGCCATGGAGATGGTGGGCTTCCTCCCCGCCACCAAGAAGCAG
ATTTTTGCCGTCCTCTCGGCCATCCTGTACCTGGGCAACGTCACTTATAAGAAGAGAGCT
ACAGGCCGAGAGGAAGGGTTGGAGGTCGGGCCACCCGAGGTGCTGGACACCCTGTCGCAG
CTTCTGAAGGTGAAGCGAGAAATCTTGGTGGAGGTTCTGACCAAAAGAAAAACGGTGACC
GTCAACGACAAGCTTATCCTTCCCTACAGCCTCAGCGAGGCCATCACTGCCCGCGACTCC
ATGGCCAAGTCTCTGTACAGCGCCCTGTTCGACTGGATTGTGCTGCGGATCAACCACGCA
CTCCTCAACAAGAAGGACGTGGAAGAGGCAGTCTCGTGCCTGTCCATTGGGGTCCTGGAC
ATCTTCGGGTTTGAAGACTTCGAGAGGAACAGCTTTGAGCAGTTCTGCATCAACTACGCC
AATGAGCAGCTGCAGTATTACTTCAACCAGCACATCTTCAAGCTGGAGCAGGAGGAATAT
CAGGGCGAGGGGATCACGTGGCACAACATCGGCTACACAGACAATGTCGGCTGCATCCAT
CTCATCAGCAAGAAACCCACGGGCCTCTTCTACCTGCTGGACGAGGAGAGCAACTTCCCC
CACGCCACGAGCCAGACCCTGCTGGCCAAGTTCAAACAGCAACATGAGGACAATAAGTAC
TTCCTGGGCACCCCGGTCATGGAGCCAGCTTTCATCATCCAGCACTTCGCAGGGAAGGTG
AAATATCAGATCAAGGACTTCCGGGAGAAGAACATGGACTACATGCGGCCAGACATCGTG
GCCCTGCTGCGGGGCAGTGACAGCTCCTACGTGCGGGAGCTCATCGGCATGGACCCCGTG
GCCGTGTTCCGCTGGGCCGTGCTCCGGGCTGCTATCCGGGCCATGGCAGTGCTTCGGGAG
GCCGGACGCCTGCGGGCCGAGAGGGCCGAAAAGGCTGCAGGTATGAGCAGCCCTGGTGCC
CAAAGTCACCCAGAAGAGCTGCCAAGAGGAGCCAGCACCCCTTCGGAAAAACTTTACCGC
GATTTGCATAACCAAATGATCAAGAGCATCAAAGGATTGCCCTGGCAGGGCGAGGACCCC
CGTAGCCTTCTCCAGTCCCTCAGTCGGCTCCAGAAACCCCGCGCCTTCATCCTGAAAAGT
AAAGGTATCAAACAAAAGCAGATCATTCCAAAGAACCTACTGGACTCCAAGTCCCTGAAA
CTCATCATCAGCATGACTCTGCACGACCGCACCACCAAGTCCCTACTGCACCTGCACAAG
AAGAAAAAGCCACCAAGCATCAGCGCCCAGTTCCAGACATCCCTTAACAAGCTCTTGGAG
GCACTGGGGAAGGCGGAGCCCTTCTTTATCCGCTGCATCCGTTCCAATGCTGAAAAGAAA
GAGCTGTGCTTTGACGACGAGCTGGTCCTGCAGCAGCTGCGCTACACCGGCATGCTGGAG
ACCGTGCGCATCCGGAGGTCAGGGTACAGCGCCAAGTACACGTTCCAGGATTTCACCGAG
CAGTTCCAGGTGCTCCTGCCCAAGGATGCCCAGCCCTGCAGGGAGGTCATCTCCACCCTC
CTGGAGAAAATGAAGATAGACAAGAGGAACTACCAGATCGGGAAGACCAAGGTCTTCCTG
AAGGAGACGGAGCGGCAAGCCCTGCAGGAGACGCTGCACCGGGAGGTGGTGCGGAAAATC
CTGCTGCTGCAGAGCTGGTTCCGGATGGTGCTGGAGCGTCGGCACTTCCTGCAGATGAAG
CGGGCCGCCGTCACCATCCAGGCCTGCTGGCGGTCCTACCGGGTCCGGAGGGCGCTGGAG
AGGACGCAGGCTGCCGTGTACCTCCAGGCCTCATGGAGGGGCTACTGGCAGCGGAAGCTC
TACCGGCACCAGAAACAGAGCATCATCCGCCTGCAGAGCCTGTGTCGGGGGCACCTGCAG
CGCAAGAGCTTCAGCCAGATGATCTCGGAGAAGCAGAAGGCAGAAGAGAAGGAGAGGGAA
GCCCTGGAAGCCGCAAGAGCAGGTGCTGAGGAGGGCGGACAGGGTCAGGCGGCTGGAGGG
CAGCAGGTAGCTGAGCAGGGGCCGGAGCCAGCGGAGGATGGCGGGCACCTGGCATCGGAG
CCTGAGGTGCAGCCAAGTGACAGGTCCCCCCTAGAGCACTCCTCACCTGAGAAGGAGGCC
CCAAGCCCAGAGAAGACTCTCCCACCCCAGAAAACCGTGGCGGCTGAAAGTCACGAGAAA
GTCCCCAGCAGCCGGGAGAAGCGTGAGTCGCGTCGGCAAAGAGGGCTGGAGCACGTCAAG
TTCCAGAACAAACACATCCAGTCCTGCAAGGAGGAGAGTGCCCTCAGAGAACCTTCCAGA
AGGGTCACCCAGGAGCAAGGGGTGAGTCTCCTGGAAGACAAAAAGGAGAGCAGAGAAGAT
GAAACCCTTCTAGTCGTAGAGACGGAGGCTGAGAACACATCTCAAAAGCAGCCCACAGAG
CAACCCCAGGCCATGGCAGTTGGCAAGGTCTCTGAAGAAACTGAGAAGACGCTGCCCAGT
GGGAGCCCCAGGCCTGGCCAGTTGGAGCGGCCGACCAGCCTGGCCCTGGACAGCAGGGTC
AGCCCACCGGCCCCTGGCAGCGCCCCCGAGACCCCCGAGGACAAGAGCAAACCATGTGGC
AGCCCAAGGGTTCAGGAAAAGCCCGACAGCCCCGGAGGCTCCACGCAGATCCAGCGGTAC
CTGGACGCCGAGCGGCTGGCCAGCGCCGTGGAACTGTGGCGGGGCAAGAAGCTGGTGGCC
GCCGCCAGCCCTAGTGCCATGCTCAGCCAGTCCCTGGACCTCAGCGACAGACACCGGGCC
ACAGGGGCCGCCCTCACGCCCACAGAGGAGAGGCGCACCTCCTTCTCCACGAGCGACGTC
TCCAAGCTCCTCCCGTCCCTGGCCAAGGCTCAGCCTGCAGCAGAAACCACGGACGGAGAG
CGAAGTGCGAAAAAGCCAGCTGTCCAGAAGAAGAAGCCAGGCGACGCATCCTCCCTCCCA
GACGCAGGGCTGTCCCCGGGCTCTCAGGTCGACTCTAAATCCACGTTTAAGAGGCTTTTT
CTGCATAAAACCAAGGATAAAAAATACAGCCTGGAGGGCGCAGAGGAGCTGGAGAATGCA
GTGTCCGGGCACGTGGTGCTGGAAGCCACCACCATGAAGAAGGGCCTGGAAGCCCCCTCC
GGACAGCAGCATCGCCACGCTGCAGGTGAGAAGCGCACCAAGGAACCAGGAGGCAAAGGG
AAGAAGAACCGAAATGTCAAGATTGGGAAGATCACAGTGTCAGAGAAGTGGCGGGAATCG
GTGTTCCGCCAGATCACCAACGCCAATGAGCTCAAGTACCTGGACGAGTTCCTGCTCAAC
AAGATAAATGACCTCCGTTCCCAGAAGACGCCCATTGAGAGCTTGTTTATCGAAGCCACC
GAGAAGTTCAGGAGCAACATCAAAACGATGTACTCTGTCCCGAACGGGAAGATCCACGTG
GGCTACAAGGATCTGATGGAGAACTACCAGATCGTCGTCAGCAACCTGGCCACTGAGCGT
GGCCAGAAGGACACCAACCTGGTCCTCAACCTCTTCCAGTCACTGCTAGATGAGTTCACC
CGTGGCTACACCAAGAACGACTTCGAGCCAGTGAAGCAGAGCAAAGCTCAGAAGAAGAAG
CGGAAGCAGGAGCGTGCTGTCCAGGAGCACAACGGGCACGTGTTCGCCAGCTACCAGGTT
AGCATCCCGCAGTCGTGCGAGCAGTGCCTCTCCTATATCTGGCTCATGGACAAGGCCCTG
CTCTGCAGCGTGTGCAAGATGACCTGCCACAAGAAGTGCGTGCACAAGATTCAGAGCCAC
TGCTCCTACACCTACGGGAGGAAGGGCGAGCCAGGCGTTGAGCCTGGCCACTTCGGCGTG
TGCGTAGACAGCCTGACCAGCGACAAGGCCTCGGTGCCCATCGTGCTGGAGAAGCTCCTG
GAACACGTGGAGATGCACGGCCTGTACACCGAGGGCCTCTACCGCAAGTCGGGTGCTGCC
AACCGCACTCGGGAGCTCCGGCAGGCGCTGCAGACAGACCCCGCAGCAGTCAAGCTGGAG
AACTTCCCCATCCACGCCATCACAGGGGTGCTGAAGCAGTGGCTGCGGGAGCTGCCCGAG
CCCCTCATGACCTTCGCACAGTACGGCGACTTCCTCCGAGCCGTCGAGCTGCCGGAGAAG
CAGGAGCAGCTGGCTGCCATCTATGCCGTCCTGGAGCACCTTCCAGAAGCCAACCACAAC
TCCCTGGAGAGACTCATCTTCCACCTTGTCAAGGTGGCCCTGCTCGAGGATGTCAACCGC
ATGTCACCTGGGGCGCTGGCCATTATCTTCGCACCCTGCCTCCTGCGCTGCCCTGACAAC
TCGGACCCGCTGACCAGCATGAAGGACGTCCTCAAGATCACCACGTGCGTGGAGATGCTG
ATCAAGGAGCAGATGAGGAAATACAAAGTGAAGATGGAGGAGATCAGCCAACTGGAGGCT
GCAGAGAGTATCGCCTTCCGCAGGCTTTCGCTCCTGCGACAAAATGCTCCATGGCCTCTC
AAACTGGGGTTTTCGTCTCCCTATGAGGGGGTCCTGAACAAGAGCCCCAAGACCCGGGAC
ATCCAGGAGGAGGAGCTGGAGGTGCTGCTGGAGGAGGAGGCAGCCGGCGGCGATGAGGAC
CGGGAAAAGGAGATTCTCATTGAACGGATCCAGTCCATCAAGGAGGAGAAGGAGGACATC
ACCTACCGGCTGCCGGAGCTGGACCCAAGGGGCTCGGACGAGGAGAACCTGGACTCGGAG
ACGTCGGCCAGCACCGAGAGCCTGCTGGAGGAGCGGGCCGGGCGGGGGGCCTCGGAAGGG
CCCCCTGCGCCTGCTCTCCCTTGCCCCGGCGCGCCCACCCCGAGCCCCCTCCCCACCGTG
GCCGCCCCTCCACGACGAAGGCCGTCGTCCTTCGTAACGGTCAGAGTGAAGACCCCCCGG
CGGACCCCCATCATGCCCACGGCCAACATCAAGCTCCCACCAGGCCTGCCCTCCCACCTG
CCTCGCTGGGCACCGGGTGCCCGGGAGGCGGCTGCCCCAGTGCGGCGCCGGGAGCCACCT
GCCCGCCGCCCGGACCAGATACATTCCGTGTACATCACGCCCGGGGCAGACCTGCCAGTG
CAGGGCGCCCTGGAGCCCCTAGAAGAGGATGGCCAGCCACCTGGGGCCAAGCGGAGGTAC
TCGGATCCCCCAACGTACTGCCTGCCCCCCGCCTCGGGCCAGACCAATGGCTGA
Protein Properties
Number of Residues 2158
Molecular Weight 243556.0
Theoretical pI 9.0
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Myosin-IXb
MSVKEAGSSGRREQAAYHLHIYPQLSTTESQASCRVTATKDSTTSDVIKDAIASLRLDGT
KCYVLVEVKESGGEEWVLDANDSPVHRVLLWPRRAQDEHPQEDGYYFLLQERNADGTIKY
VHMQLVAQATATRRLVERGLLPRQQADFDDLCNLPELTEGNLLKNLKHRFLQQKIYTYAG
SILVAINPFKFLPIYNPKYVKMYENQQLGKLEPHVFALADVAYYTMLRKRVNQCIVYPGE
SGSGKTQSTNFLIHCLTALSQKGYASGVERTILGACPVLEAFGNAKTAHNNNSSRFGKFI
QVSYLESGIVRGAVVEKYLLEKSRLVSQEKDERNYHVFYYLLLGVSEEERQEFQLKQPED
YFYLNQHNLKIEDGEDLKHDFERLKQAMEMVGFLPATKKQIFAVLSAILYLGNVTYKKRA
TGREEGLEVGPPEVLDTLSQLLKVKREILVEVLTKRKTVTVNDKLILPYSLSEAITARDS
MAKSLYSALFDWIVLRINHALLNKKDVEEAVSCLSIGVLDIFGFEDFERNSFEQFCINYA
NEQLQYYFNQHIFKLEQEEYQGEGITWHNIGYTDNVGCIHLISKKPTGLFYLLDEESNFP
HATSQTLLAKFKQQHEDNKYFLGTPVMEPAFIIQHFAGKVKYQIKDFREKNMDYMRPDIV
ALLRGSDSSYVRELIGMDPVAVFRWAVLRAAIRAMAVLREAGRLRAERAEKAAGMSSPGA
QSHPEELPRGASTPSEKLYRDLHNQMIKSIKGLPWQGEDPRSLLQSLSRLQKPRAFILKS
KGIKQKQIIPKNLLDSKSLKLIISMTLHDRTTKSLLHLHKKKKPPSISAQFQTSLNKLLE
ALGKAEPFFIRCIRSNAEKKELCFDDELVLQQLRYTGMLETVRIRRSGYSAKYTFQDFTE
QFQVLLPKDAQPCREVISTLLEKMKIDKRNYQIGKTKVFLKETERQALQETLHREVVRKI
LLLQSWFRMVLERRHFLQMKRAAVTIQACWRSYRVRRALERTQAAVYLQAAWRGYWQRKL
YRHQKQSIIRLQSLCRGHLQRKSFSQMISEKQKAEEKEREALEAARAGAEEGGQGQAAGG
QQVAEQGPEPAEDGGHLASEPEVQPSDRSPLEHSSPEKEAPSPEKTLPPQKTVAAESHEK
VPSSREKRESRRQRGLEHVKFQNKHIQSCKEESALREPSRRVTQEQGVSLLEDKKESRED
ETLLVVETEAENTSQKQPTEQPQAMAVGKVSEETEKTLPSGSPRPGQLERPTSLALDSRV
SPPAPGSAPETPEDKSKPCGSPRVQEKPDSPGGSTQIQRYLDAERLASAVELWRGKKLVA
AASPSAMLSQSLDLSDRHRATGAALTPTEERRTSFSTSDVSKLLPSLAKAQPAAETTDGE
RSAKKPAVQKKKPGDASSLPDAGLSPGSQVDSKSTFKRLFLHKTKDKKYSLEGAEELENA
VSGHVVLEATTMKKGLEAPSGQQHRHAAGEKRTKEPGGKGKKNRNVKIGKITVSEKWRES
VFRQITNANELKYLDEFLLNKINDLRSQKTPIESLFIEATEKFRSNIKTMYSVPNGKIHV
GYKDLMENYQIVVSNLATERGQKDTNLVLNLFQSLLDEFTRGYTKNDFEPVKQSKAQKKK
RKQERAVQEHNGHVFASYQVSIPQSCEQCLSYIWLMDKALLCSVCKMTCHKKCVHKIQSH
CSYTYGRKGEPGAEPGHFGVCVDSLTSDKASVPIVLEKLLEHVEMHGLYTEGLYRKSGAA
NRTRELRQALQTDPAAVKLENFPIHAITGVLKQWLRELPEPLMTFAQYGDFLRAVELPEK
QEQLAAIYAVLEHLPEANHNSLERLIFHLVKVALLEDVNRMSPGALAIIFAPCLLRCPDN
SDPLTSMKDVLKITTCVEMLIKEQMRKYKVKMEEISQLEAAESIAFRRLSLLRQNAPWPL
KLGFSSPYEGVLNKSPQVPRDIQEEELEVLLEEEAAGGDEDREKEILIERIQSIKEEKED
ITYRLPELDPRGSDEENLDSETSASTESLLEERAGRGASEGPPAPALPCPGAPTPSPLPT
VAAPPRRRPSSFVTVRVKTPRRTPIMPTANIKLPPGLPSHLPRWAPGAREAAAPVRRREP
PARRPDQIHSVYITPGADLPVQGALEPLEEDGQPPGAKRRYSDPPTYCLPPASGQTNG
GenBank ID Protein 33356170
UniProtKB/Swiss-Prot ID Q13459
UniProtKB/Swiss-Prot Entry Name MYO9B_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_004145
GeneCard ID MYO9B
GenAtlas ID MYO9B
HGNC ID HGNC:7609
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  7. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  8. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  9. Wang B, Malik R, Nigg EA, Korner R: Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Anal Chem. 2008 Dec 15;80(24):9526-33. doi: 10.1021/ac801708p. [PubMed:19007248 ]
  10. Carrascal M, Ovelleiro D, Casas V, Gay M, Abian J: Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment. J Proteome Res. 2008 Dec;7(12):5167-76. [PubMed:19367720 ]
  11. Wirth JA, Jensen KA, Post PL, Bement WM, Mooseker MS: Human myosin-IXb, an unconventional myosin with a chimerin-like rho/rac GTPase-activating protein domain in its tail. J Cell Sci. 1996 Mar;109 ( Pt 3):653-61. [PubMed:8907710 ]
  12. Grewal PK, Jones AM, Maconochie M, Lemmers RJ, Frants RR, Hewitt JE: Cloning of the murine unconventional myosin gene Myo9b and identification of alternative splicing. Gene. 1999 Nov 29;240(2):389-98. [PubMed:10580159 ]
  13. Post PL, Bokoch GM, Mooseker MS: Human myosin-IXb is a mechanochemically active motor and a GAP for rho. J Cell Sci. 1998 Apr;111 ( Pt 7):941-50. [PubMed:9490638 ]
  14. Monsuur AJ, de Bakker PI, Alizadeh BZ, Zhernakova A, Bevova MR, Strengman E, Franke L, van't Slot R, van Belzen MJ, Lavrijsen IC, Diosdado B, Daly MJ, Mulder CJ, Mearin ML, Meijer JW, Meijer GA, van Oort E, Wapenaar MC, Koeleman BP, Wijmenga C: Myosin IXB variant increases the risk of celiac disease and points toward a primary intestinal barrier defect. Nat Genet. 2005 Dec;37(12):1341-4. Epub 2005 Nov 13. [PubMed:16282976 ]