You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07832
Secondary Accession Numbers
  • 13541
Name NKG2D ligand 3
Synonyms
  1. ALCAN-gamma
  2. N2DL-3
  3. NKG2DL3
  4. Retinoic acid early transcript 1N
Gene Name ULBP3
Protein Type Unknown
Biological Properties
General Function Involved in immune response
Specific Function Ligand for the NKG2D receptor, together with at least ULBP1 and ULBP2. ULBPs activate multiple signaling pathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway. Has lower affinity for NKG2D compared to ULBP1 and ULBP2 and induces weaker signaling responses than does ULBP2 or ULBP1
Pathways Not Available
Reactions Not Available
GO Classification
Component
mhc protein complex
mhc class i protein complex
membrane
cell part
macromolecular complex
protein complex
Process
antigen processing and presentation
immune system process
immune response
Cellular Location
  1. Cell membrane
  2. Lipid-anchor
  3. GPI-anchor
Gene Properties
Chromosome Location Chromosome:6
Locus 6q25
SNPs ULBP3
Gene Sequence
>735 bp
ATGGCAGCGGCCGCCAGCCCCGCGATCCTTCCGCGCCTCGCGATTCTTCCGTACCTGCTA
TTCGACTGGTCCGGGACGGGGCGGGCCGACGCTCACTCTCTCTGGTATAACTTCACCATC
ATTCATTTGCCCAGACATGGGCAACAGTGGTGTGAGGTCCAGAGCCAGGTGGATCAGAAG
AATTTTCTCTCCTATGACTGTGGCAGTGACAAGGTCTTATCTATGGGTCACCTAGAAGAG
CAGCTGTATGCCACAGATGCCTGGGGAAAACAACTGGAAATGCTGAGAGAGGTGGGGCAG
AGGCTCAGACTGGAACTGGCTGACACTGAGCTGGAGGATTTCACACCCAGTGGACCCCTC
ACGCTGCAGGTCAGGATGTCTTGTGAGTGTGAAGCCGATGGATACATCCGTGGATCTTGG
CAGTTCAGCTTCGATGGACGGAAGTTCCTCCTCTTTGACTCAAACAACAGAAAGTGGACA
GTGGTTCACGCTGGAGCCAGGCGGATGAAAGAGAAGTGGGAGAAGGATAGCGGACTGACC
ACCTTCTTCAAGATGGTCTCAATGAGAGACTGCAAGAGCTGGCTTAGGGACTTCCTGATG
CACAGGAAGAAGAGGCTGGAACCCACAGCACCACCCACCATGGCCCCAGGCTTAGCTCAA
CCCAAAGCCATAGCCACCACCCTCAGTCCCTGGAGCTTCCTCATCATCCTCTGCTTCATC
CTCCCTGGCATCTGA
Protein Properties
Number of Residues 244
Molecular Weight 27949.0
Theoretical pI 8.13
Pfam Domain Function
Signals
  • 1-29
Transmembrane Regions
  • None
Protein Sequence
>NKG2D ligand 3
MAAAASPAILPRLAILPYLLFDWSGTGRADAHSLWYNFTIIHLPRHGQQWCEVQSQVDQK
NFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPL
TLQVRMSCECEADGYIRGSWQFSFDGRKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLT
TFFKMVSMRDCKSWLRDFLMHRKKRLEPTAPPTMAPGLAQPKAIATTLSPWSFLIILCFI
LPGI
GenBank ID Protein 14530667
UniProtKB/Swiss-Prot ID Q9BZM4
UniProtKB/Swiss-Prot Entry Name N2DL3_HUMAN
PDB IDs
GenBank Gene ID AB052908
GeneCard ID ULBP3
GenAtlas ID ULBP3
HGNC ID HGNC:14895
References
General References
  1. Cosman D, Mullberg J, Sutherland CL, Chin W, Armitage R, Fanslow W, Kubin M, Chalupny NJ: ULBPs, novel MHC class I-related molecules, bind to CMV glycoprotein UL16 and stimulate NK cytotoxicity through the NKG2D receptor. Immunity. 2001 Feb;14(2):123-33. [PubMed:11239445 ]
  2. Radosavljevic M, Cuillerier B, Wilson MJ, Clement O, Wicker S, Gilfillan S, Beck S, Trowsdale J, Bahram S: A cluster of ten novel MHC class I related genes on human chromosome 6q24.2-q25.3. Genomics. 2002 Jan;79(1):114-23. [PubMed:11827464 ]
  3. Steinle A, Li P, Morris DL, Groh V, Lanier LL, Strong RK, Spies T: Interactions of human NKG2D with its ligands MICA, MICB, and homologs of the mouse RAE-1 protein family. Immunogenetics. 2001 May-Jun;53(4):279-87. [PubMed:11491531 ]
  4. Cerwenka A, Lanier LL: NKG2D ligands: unconventional MHC class I-like molecules exploited by viruses and cancer. Tissue Antigens. 2003 May;61(5):335-43. [PubMed:12753652 ]
  5. Radaev S, Rostro B, Brooks AG, Colonna M, Sun PD: Conformational plasticity revealed by the cocrystal structure of NKG2D and its class I MHC-like ligand ULBP3. Immunity. 2001 Dec;15(6):1039-49. [PubMed:11754823 ]