Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07833
Secondary Accession Numbers
  • 13542
Name Sodium leak channel non-selective protein
Synonyms
  1. CanIon
  2. Voltage gated channel-like protein 1
Gene Name NALCN
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Voltage-independent, cation-nonselective channel which is permeable to sodium, potassium and calcium ions. Responsible for the background sodium ion leak current in neurons and controls neuronal excitability. Activated either by neuropeptides substance P or neurotensin. Required for normal respiratory rhythm and neonatal survival
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
Process
establishment of localization
transport
transmembrane transport
ion transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 13q32.3
SNPs NALCN
Gene Sequence
>5217 bp
ATGCTCAAAAGGAAGCAGAGTTCCAGGGTGGAAGCCCAGCCAGTCACTGACTTTGGTCCT
GATGAGTCTCTGTCGGATAATGCTGACATCCTCTGGATTAACAAACCATGGGTTCACTCT
TTGCTGCGCATCTGTGCCATCATCAGCGTCATTTCTGTTTGTATGAATACGCCAATGACC
TTCGAGCACTATCCTCCACTTCAGTATGTGACCTTCACTTTGGATACATTATTGATGTTT
CTCTACACGGCAGAGATGATAGCAAAAATGCACATCCGGGGCATTGTCAAGGGGGATAGT
TCCTATGTGAAAGATCGCTGGTGTGTTTTTGATGGATTTATGGTCTTTTGCCTTTGGGTT
TCTTTGGTGCTACAGGTGTTTGAAATTGCTGATATAGTTGATCAGATGTCACCTTGGGGC
ATGTTGCGGATTCCACGGCCACTGATTATGATCCGAGCATTCCGGATTTATTTCCGATTT
GAACTGCCAAGGACCAGAATTACAAATATTTTAAAGCGATCGGGAGAACAAATATGGAGT
GTTTCCATTTTTCTACTTTTCTTTCTACTTCTTTATGGAATTTTAGGAGTTCAGATGTTT
GGAACATTTACTTATCACTGTGTTGTAAATGACACAAAGCCAGGGAATGTAACCTGGAAT
AGTTTAGCTATTCCAGACACACACTGCTCACCAGAGCTAGAAGAAGGCTACCAGTGCCCA
CCTGGATTTAAATGCATGGACCTTGAAGATCTGGGACTTAGCAGGCAAGAGCTGGGCTAC
AGTGGCTTTAATGAGATAGGAACTAGTATATTCACCGTCTATGAGGCCGCCTCACAGGAA
GGCTGGGTGTTCCTCATGTACAGAGCAATTGACAGCTTTCCCCGTTGGCGTTCCTACTTC
TATTTCATCACTCTCATTTTCTTCCTCGCCTGGCTTGTGAAGAACGTGTTTATTGCTGTT
ATCATTGAAACATTTGCAGAAATCAGAGTACAGTTTCAACAAATGTGGGGATCGAGAAGC
AGCACTACCTCAACAGCCACCACCCAGATGTTTCATGAAGATGCTGCTGGAGGTTGGCAG
CTGGTAGCTGTGGATGTCAACAAGCCCCAGGGACGCGCCCCAGCCTGCCTCCAGAAAATG
ATGCGGTCATCCGTTTTCCACATGTTCATCCTGAGCATGGTGACCGTGGACGTGATCGTG
GCGGCTAGCAACTACTACAAAGGAGAAAACTTCAGGAGGCAGTACGACGAGTTCTACCTG
GCGGAGGTGGCTTTTACAGTACTTTTTGATTTGGAAGCACTTCTGAAGATATGGTGTTTG
GGATTTACTGGATATATTAGCTCATCTCTCCACAAATTCGAACTACTACTCGTAATTGGA
ACTACTCTTCATGTATACCCAGATCTTTATCATTCACAATTCACGTACTTTCAGGTTCTC
CGAGTAGTTCGGCTGATTAAGATTTCACCTGCATTAGAAGACTTTGTGTACAAGATATTT
GGTCCTGGAAAAAAGCTTGGGAGTTTGGTTGTATTTACTGCCAGCCTCTTGATTGTTATG
TCAGCAATTAGTTTGCAGATGTTCTGCTTTGTCGAAGAACTGGACAGATTTACTACGTTT
CCGAGGGCATTTATGTCCATGTTCCAGATCCTCACCCAGGAAGGATGGGTGGACGTAATG
GACCAAACTCTAAATGCTGTGGGACATATGTGGGCACCCGTGGTTGCCATCTATTTCATT
CTCTATCATCTTTTTGCCACTCTGATCCTCCTGAGTTTGTTTGTTGCTGTTATTTTGGAC
AACTTAGAACTTGATGAAGACCTAAAGAAGCTTAAACAATTAAAGCAAAGTGAAGCAAAT
GCGGACACCAAAGAAAAGCTCCCTTTACGCCTGCGAATCTTTGAAAAATTTCCAAACAGA
CCTCAAATGGTGAAAATCTCAAAGCTTCCTTCAGATTTTACAGTTCCTAAAATCAGGGAG
AGTTTTATGAAGCAGTTTATTGACCGCCAGCAACAGGACACATGTTGCCTCCTGAGAAGC
CTCCCGACCACCTCTTCCTCCTCCTGCGACCACTCCAAACGCTCAGCAATTGAGGACAAC
AAATACATCGACCAAAAACTTCGCAAGTCTGTTTTCAGCATCAGGGCAAGGAACCTTCTG
GAAAAGGAGACCGCAGTCACTAAAATCTTAAGAGCTTGCACCCGACAGCGCATGCTGAGC
GGATCATTTGAGGGGCAGCCCGCAAAGGAGAGGTCAATCCTCAGCGTGCAGCATCATATC
CGCCAAGAGCGCAGGTCACTAAGACATGGATCAAACAGCCAGAGGATCAGCAGGGGAAAA
TCTCTTGAAACTTTGACTCAAGATCATTCCAATACAGTGAGATATAGAAATGCACAAAGA
GAAGACAGTGAAATAAAGATGATTCAGGAAAAAAAGGAGCAAGCAGAGATGAAAAGGAAA
GTGCAAGAAGAGGAACTCAGAGAGAACCACCCATACTTCGATAAGCCACTGTTCATTGTC
GGGCGAGAACACAGGTTCAGAAACTTTTGCCGGGTGGTGGTCCGAGCACGCTTCAACGCA
TCTAAAACAGACCCTGTCACAGGAGCTGTGAAAAATACAAAGTACCATCAACTTTATGAT
TTGCTGGGATTGGTCACTTACCTGGACTGGGTCATGATCATCGTAACCATCTGCTCTTGC
ATTTCCATGATGTTTGAGTCCCCGTTTCGAAGAGTCATGCATGCACCTACTTTGCAGATT
GCTGAGTATGTGTTTGTGATATTCATGAGCATTGAGCTTAATCTGAAGATTATGGCAGAT
GGCTTATTTTTCACTCCAACTGCTGTCATCAGGGACTTCGGTGGAGTAATGGACATATTT
ATATATCTTGTGAGCTTGATATTTCTTTGTTGGATGCCTCAAAATGTACCTGCTGAATCG
GGAGCTCAGCTTCTAATGGTCCTTCGGTGCCTGAGACCTCTGCGCATATTCAAACTGGTG
CCCCAGATGAGGAAAGTTGTTCGAGAACTTTTCAGCGGCTTCAAGGAAATTTTTTTGGTC
TCCATTCTTTTGCTGACATTAATGCTCGTTTTTGCAAGCTTTGGAGTTCAGCTTTTTGCT
GGAAAACTGGCCAAGTGCAATGATCCCAACATTATTAGAAGGGAAGATTGCAATGGCATA
TTCAGAATTAATGTCAGTGTGTCAAAGAACTTAAATTTAAAATTGAGGCCTGGAGAGAAA
AAACCTGGATTTTGGGTGCCCCGTGTTTGGGCGAATCCTCGGAACTTTAATTTCGACAAT
GTGGGAAACGCTATGCTGGCGTTGTTTGAAGTTCTCTCCTTGAAAGGCTGGGTGGAAGTG
AGAGATGTTATTATTCATCGTGTGGGGCCGATCCATGGAATCTATATTCATGTTTTTGTA
TTCCTGGGTTGCATGATTGGACTGACCCTTTTTGTTGGAGTAGTTATTGCTAATTTCAAT
GAAAACAAGGGGACGGCTTTGCTGACCGTCGATCAGAGAAGATGGGAAGACCTGAAGAGC
CGACTGAAGATCGCACAGCCTCTTCATCTTCCGCCTCGCCCGGATAATGATGGTTTTAGA
GCTAAAATGTATGACATAACCCAGCATCCATTTTTTAAGAGGACAATCGCATTACTCGTC
CTGGCCCAGTCGGTGTTGCTCTCTGTCAAGTGGGACGTCGAGGACCCGGTGACCGTACCT
TTGGCAACAATGTCAGTTGTTTTCACCTTCATCTTTGTTCTGGAGGTTACCATGAAGATC
ATAGCAATGTCGCCTGCTGGCTTCTGGCAAAGCAGAAGAAACCGATACGATCTCCTGGTG
ACGTCGCTTGGCGTTGTATGGGTGGTGCTTCACTTTGCCCTCCTGAATGCATATACTTAC
ATGATGGGCGCTTGTGTGATTGTATTTAGGTTTTTCTCCATCTGTGGAAAACATGTAACG
CTAAAGATGCTCCTCTTGACAGTGGTCGTCAGCATGTACAAGAGCTTCTTTATCATAGTA
GGCATGTTTCTCTTGCTGCTGTGTTACGCTTTTGCTGGAGTTGTTTTATTTGGTACTGTG
AAATATGGGGAGAATATTAACAGGCATGCAAATTTTTCTTCGGCTGGAAAAGCTATTACC
GTACTGTTCCGAATTGTCACAGGTGAAGACTGGAACAAGATTATGCATGACTGTATGGTT
CAGCCTCCGTTTTGTACTCCAGATGAATTTACATACTGGGCAACAGACTGTGGAAATTAT
GCTGGGGCACTTATGTATTTCTGTTCATTTTATGTCATCATTGCCTACATCATGCTAAAT
CTGCTTGTAGCCATAATTGTGGAGAATTTCTCCTTGTTTTATTCCACTGAGGAGGACCAG
CTTTTAAGTTACAATGATCTTCGCCACTTTCAAATAATATGGAACATGGTGGATGATAAA
AGAGAGGGGGTGATCCCCACGTTCCGCGTCAAGTTCCTGCTGCGGCTACTGCGTGGGAGG
CTGGAGGTGGACCTGGACAAGGACAAGCTCCTGTTTAAGCACATGTGCTACGAAATGGAG
AGGCTCCACAATGGCGGCGACGTCACCTTCCATGATGTCCTGAGCATGCTTTCATACCGG
TCCGTGGACATCCGGAAGAGCTTGCAGCTGGAGGAACTCCTGGCGAGGGAGCAGCTGGAG
TACACCATAGAGGAGGAGGTGGCCAAGCAGACCATCCGCATGTGGCTCAAGAAGTGCCTG
AAGCGCATCAGAGCTAAACAGCAGCAGTCGTGCAGTATCATCCACAGCCTGAGAGAGAGT
CAGCAGCAAGAGCTGAGCCGGTTTCTGAACCCGCCCAGCATCGAGACCACCCAGCCCAGT
GAGGACACGAATGCCAACAGTCAGGACAACAGCATGCAACCTGAGACAAGCAGCCAGCAG
CAGCTCCTGAGCCCCACGCTGTCGGATCGAGGAGGAAGTCGGCAAGATGCAGCCGACGCA
GGGAAACCCCAGAGGAAATTTGGGCAGTGGCGTCTGCCCTCAGCCCCAAAACCAATAAGC
CATTCAGTGTCCTCAGTCAACTTACGGTTTGGAGGAAGGACAACCATGAAATCTGTCGTG
TGCAAAATGAACCCCATGACTGACGCGGCTTCCTGCGGTTCTGAAGTTAAGAAGTGGTGG
ACCCGGCAGCTGACTGTGGAGAGCGACGAAAGTGGGGATGACCTTCTGGATATTTAG
Protein Properties
Number of Residues 1738
Molecular Weight 200329.6
Theoretical pI 8.84
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 41-61
  • 67-87
  • 107-127
  • 139-158
  • 183-203
  • 302-322
  • 383-403
  • 423-443
  • 449-468
  • 477-500
  • 510-530
  • 579-599
  • 881-901
  • 924-944
  • 953-973
  • 980-997
  • 1016-1036
  • 1136-1156
  • 1210-1227
  • 1236-1256
  • 1278-1298
  • 1300-1316
  • 1336-1356
  • 1427-1447
Protein Sequence
>Sodium leak channel non-selective protein
MLKRKQSSRVEAQPVTDFGPDESLSDNADILWINKPWVHSLLRICAIISVISVCMNTPMT
FEHYPPLQYVTFTLDTLLMFLYTAEMIAKMHIRGIVKGDSSYVKDRWCVFDGFMVFCLWV
SLVLQVFEIADIVDQMSPWGMLRIPRPLIMIRAFRIYFRFELPRTRITNILKRSGEQIWS
VSIFLLFFLLLYGILGVQMFGTFTYHCVVNDTKPGNVTWNSLAIPDTHCSPELEEGYQCP
PGFKCMDLEDLGLSRQELGYSGFNEIGTSIFTVYEAASQEGWVFLMYRAIDSFPRWRSYF
YFITLIFFLAWLVKNVFIAVIIETFAEIRVQFQQMWGSRSSTTSTATTQMFHEDAAGGWQ
LVAVDVNKPQGRAPACLQKMMRSSVFHMFILSMVTVDVIVAASNYYKGENFRRQYDEFYL
AEVAFTVLFDLEALLKIWCLGFTGYISSSLHKFELLLVIGTTLHVYPDLYHSQFTYFQVL
RVVRLIKISPALEDFVYKIFGPGKKLGSLVVFTASLLIVMSAISLQMFCFVEELDRFTTF
PRAFMSMFQILTQEGWVDVMDQTLNAVGHMWAPVVAIYFILYHLFATLILLSLFVAVILD
NLELDEDLKKLKQLKQSEANADTKEKLPLRLRIFEKFPNRPQMVKISKLPSDFTVPKIRE
SFMKQFIDRQQQDTCCLLRSLPTTSSSSCDHSKRSAIEDNKYIDQKLRKSVFSIRARNLL
EKETAVTKILRACTRQRMLSGSFEGQPAKERSILSVQHHIRQERRSLRHGSNSQRISRGK
SLETLTQDHSNTVRYRNAQREDSEIKMIQEKKEQAEMKRKVQEEELRENHPYFDKPLFIV
GREHRFRNFCRVVVRARFNASKTDPVTGAVKNTKYHQLYDLLGLVTYLDWVMIIVTICSC
ISMMFESPFRRVMHAPTLQIAEYVFVIFMSIELNLKIMADGLFFTPTAVIRDFGGVMDIF
IYLVSLIFLCWMPQNVPAESGAQLLMVLRCLRPLRIFKLVPQMRKVVRELFSGFKEIFLV
SILLLTLMLVFASFGVQLFAGKLAKCNDPNIIRREDCNGIFRINVSVSKNLNLKLRPGEK
KPGFWVPRVWANPRNFNFDNVGNAMLALFEVLSLKGWVEVRDVIIHRVGPIHGIYIHVFV
FLGCMIGLTLFVGVVIANFNENKGTALLTVDQRRWEDLKSRLKIAQPLHLPPRPDNDGFR
AKMYDITQHPFFKRTIALLVLAQSVLLSVKWDVEDPVTVPLATMSVVFTFIFVLEVTMKI
IAMSPAGFWQSRRNRYDLLVTSLGVVWVVLHFALLNAYTYMMGACVIVFRFFSICGKHVT
LKMLLLTVVVSMYKSFFIIVGMFLLLLCYAFAGVVLFGTVKYGENINRHANFSSAGKAIT
VLFRIVTGEDWNKIMHDCMVQPPFCTPDEFTYWATDCGNYAGALMYFCSFYVIIAYIMLN
LLVAIIVENFSLFYSTEEDQLLSYNDLRHFQIIWNMVDDKREGVIPTFRVKFLLRLLRGR
LEVDLDKDKLLFKHMCYEMERLHNGGDVTFHDVLSMLSYRSVDIRKSLQLEELLAREQLE
YTIEEEVAKQTIRMWLKKCLKRIRAKQQQSCSIIHSLRESQQQELSRFLNPPSIETTQPS
EDTNANSQDNSMQPETSSQQQLLSPTLSDRGGSRQDAADAGKPQRKFGQWRLPSAPKPIS
HSVSSVNLRFGGRTTMKSVVCKMNPMTDAASCGSEVKKWWTRQLTVESDESGDDLLDI
GenBank ID Protein 24119274
UniProtKB/Swiss-Prot ID Q8IZF0
UniProtKB/Swiss-Prot Entry Name NALCN_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_052867.2
GeneCard ID NALCN
GenAtlas ID NALCN
HGNC ID HGNC:19082
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ: Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Nat Biotechnol. 2005 Jan;23(1):94-101. Epub 2004 Dec 12. [PubMed:15592455 ]
  4. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. [PubMed:15057823 ]
  5. Chumakov I, Blumenfeld M, Guerassimenko O, Cavarec L, Palicio M, Abderrahim H, Bougueleret L, Barry C, Tanaka H, La Rosa P, Puech A, Tahri N, Cohen-Akenine A, Delabrosse S, Lissarrague S, Picard FP, Maurice K, Essioux L, Millasseau P, Grel P, Debailleul V, Simon AM, Caterina D, Dufaure I, Malekzadeh K, Belova M, Luan JJ, Bouillot M, Sambucy JL, Primas G, Saumier M, Boubkiri N, Martin-Saumier S, Nasroune M, Peixoto H, Delaye A, Pinchot V, Bastucci M, Guillou S, Chevillon M, Sainz-Fuertes R, Meguenni S, Aurich-Costa J, Cherif D, Gimalac A, Van Duijn C, Gauvreau D, Ouellette G, Fortier I, Raelson J, Sherbatich T, Riazanskaia N, Rogaev E, Raeymaekers P, Aerssens J, Konings F, Luyten W, Macciardi F, Sham PC, Straub RE, Weinberger DR, Cohen N, Cohen D: Genetic and physiological data implicating the new human gene G72 and the gene for D-amino acid oxidase in schizophrenia. Proc Natl Acad Sci U S A. 2002 Oct 15;99(21):13675-80. Epub 2002 Oct 3. [PubMed:12364586 ]
  6. Lu B, Su Y, Das S, Liu J, Xia J, Ren D: The neuronal channel NALCN contributes resting sodium permeability and is required for normal respiratory rhythm. Cell. 2007 Apr 20;129(2):371-83. [PubMed:17448995 ]