You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07836
Secondary Accession Numbers
  • 13545
Name Sodium/potassium/calcium exchanger 6
Synonyms
  1. Na(+)/K(+)/Ca(2+)-exchange protein 6
  2. Solute carrier family 24 member 6
Gene Name SLC24A6
Protein Type Unknown
Biological Properties
General Function Involved in transmembrane transport
Specific Function Transports Ca(2+) in exchange for either Li(+) or Na(+), explaining how Li(+) catalyzes Ca(2+) exchange. In contrast to other members of the family its function is independent of K(+)
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 12q24.13
SNPs SLC24A6
Gene Sequence
>1755 bp
ATGGCCGGCAGAAGGCTGAATCTGCGCTGGGCACTGAGTGTGCTTTGTGTGCTGCTAATG
GCGGAGACAGTGTCTGGGACTAGGGGCTCGTCTACAGGAGCTCACATTAGCCCCCAGTTT
CCAGCTTCAGGTGTGAACCAGACCCCCGTGGTAGACTGCCGCAAGGTGTGTGGCCTGAAT
GTCTCTGACCGCTGTGACTTCATCCGGACCAACCCTGACTGCCACAGTGATGGGGGGTAC
CTGGACTACCTGGAAGGCATCTTCTGCCACTTCCCTCCCAGCCTCCTCCCTCTGGCTGTC
ACTCTCTACGTTTCCTGGCTGCTCTACCTGTTTCTGATTCTGGGAGTCACCGCAGCCAAG
TTTTTCTGCCCCAACTTGTCGGCCATTTCTACCACACTGAAGCTCTCCCACAACGTGGCA
GGCGTCACCTTCCTGGCATTTGGGAATGGTGCACCTGACATCTTCAGTGCCCTGGTGGCC
TTCTCTGACCCGCACACAGCCGGCCTGGCCCTTGGGGCACTGTTTGGCGCTGGCGTGCTG
GTTACCACAGTGGTGGCCGGAGGCATTACCATCCTACACCCCTTCATGGCTGCCTCCAGG
CCCTTCTTCAGGGACATCGTTTTCTACATGGTGGCTGTGTTCCTGACCTTCCTCATGCTC
TTCCGTGGCAGGGTCACCCTGGCATGGGCTCTGGGTTACCTGGGCTTGTATGTGTTCTAT
GTGGTCACTGTGATTCTCTGCACCTGGATCTACCAACGGCAACGGAGAGGATCTCTGTTC
TGCCCCATGCCAGTTACTCCAGAGATCCTCTCAGACTCCGAGGAGGACCGGGTATCTTCT
AATACCAACAGCTATGACTACGGTGATGAGTACCGGCCGCTGTTCTTCTACCAGGAGACC
ACGGCTCAGATCCTGGTCCGGGCCCTCAATCCCCTGGATTACATGAAGTGGAGAAGGAAA
TCAGCATACTGGAAAGCCCTCAAGGTGTTCAAGCTGCCTGTGGAGTTCCTGCTGCTCCTC
ACAGTCCCCGTCGTGGACCCGGACAAGGATGACCAGAACTGGAAACGGCCCCTCAACTGT
CTGCATCTGGTTATCAGCCCCCTGGTTGTGGTCCTGACCCTGCAGTCGGGGACCTATGGT
GTCTATGAGATAGGCGGCCTCGTTCCCGTCTGGGTCGTGGTGGTGATCGCAGGCACAGCC
TTGGCTTCAGTGACCTTTTTTGCCACATCTGACAGCCAGCCCCCCAGGCTTCACTGGCTC
TTTGCTTTCCTGGGCTTTCTGACCAGCGCCCTGTGGATCAACGCGGCCGCCACAGAGGTG
GTGAACATCTTGCGGTCCCTGGGTGTGGTCTTCCGGCTGAGCAACACTGTGCTGGGGCTC
ACGCTGCTGGCCTGGGGGAACAGCATTGGAGATGCCTTCTCGGATTTCACACTGGCTCGC
CAGGGCTACCCACGGATGGCGTTCTCCGCCTGCTTTGGCGGCATCATCTTCAACATCCTC
GTGGGTGTGGGGCTGGGCTGCCTGCTCCAGATCTCCCGAAGCCACACAGAAGTGAAGCTG
GAGCCAGACGGACTGCTGGTGTGGGTCCTGGCAGGCGCCCTGGGGCTCAGCCTCGTCTTC
TCCCTGGTCTCAGTCCCATTGCAGTGCTTCCAGCTCAGCAGAGTCTATGGCTTCTGCCTG
CTCCTCTTCTACCTGAACTTCCTTGTCGTGGCCCTCCTCACTGAATTTGGAGTGATTCAC
CTGAAAAGCATGTGA
Protein Properties
Number of Residues 584
Molecular Weight 64230.8
Theoretical pI 8.07
Pfam Domain Function
Signals
  • 1-26
Transmembrane Regions
  • 96-116
  • 141-161
  • 169-189
  • 201-221
  • 227-247
  • 326-346
  • 361-381
  • 384-404
  • 417-437
  • 446-466
  • 488-508
  • 525-545
  • 559-579
Protein Sequence
>Sodium/potassium/calcium exchanger 6
MAGRRLNLRWALSVLCVLLMAETVSGTRGSSTGAHISPQFPASGVNQTPVVDCRKVCGLN
VSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAK
FFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVAFSDPHTAGLALGALFGAGVL
VTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFY
VVTVILCTWIYQRQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPLFFYQET
TAQILVRALNPLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNC
LHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWL
FAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLAR
QGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVF
SLVSVPLQCFQLSRVYGFCLLLFYLNFLVVALLTEFGVIHLKSM
GenBank ID Protein 39995086
UniProtKB/Swiss-Prot ID Q6J4K2
UniProtKB/Swiss-Prot Entry Name NCKX6_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_024959.2
GeneCard ID SLC24A6
GenAtlas ID SLC24A6
HGNC ID HGNC:26175
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. [PubMed:16541075 ]
  4. Palty R, Ohana E, Hershfinkel M, Volokita M, Elgazar V, Beharier O, Silverman WF, Argaman M, Sekler I: Lithium-calcium exchange is mediated by a distinct potassium-independent sodium-calcium exchanger. J Biol Chem. 2004 Jun 11;279(24):25234-40. Epub 2004 Apr 1. [PubMed:15060069 ]