You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07842
Secondary Accession Numbers
  • 13551
Name Substance-P receptor
Synonyms
  1. NK-1 receptor
  2. NK-1R
  3. SPR
  4. Tachykinin receptor 1
Gene Name TACR1
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function This is a receptor for the tachykinin neuropeptide substance P. It is probably associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is:substance P > substance K > neuromedin-K
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
plasma membrane
intrinsic to membrane
integral to membrane
Function
neuropeptide receptor activity
tachykinin receptor activity
receptor activity
molecular transducer activity
signal transducer activity
peptide receptor activity
peptide receptor activity, g-protein coupled
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:2
Locus 2p12
SNPs TACR1
Gene Sequence
>1224 bp
ATGGATAACGTCCTCCCGGTGGACTCAGACCTCTCCCCAAACATCTCCACTAACACCTCG
GAACCCAATCAGTTCGTGCAACCAGCCTGGCAAATTGTCCTTTGGGCAGCTGCCTACACG
GTCATTGTGGTGACCTCTGTGGTGGGCAACGTGGTAGTGATGTGGATCATCTTAGCCCAC
AAAAGAATGAGGACAGTGACGAACTATTTTCTGGTGAACCTGGCCTTCGCGGAGGCCTCC
ATGGCTGCATTCAATACAGTGGTGAACTTCACCTATGCTGTCCACAACGAATGGTACTAC
GGCCTGTTCTACTGCAAGTTCCACAACTTCTTCCCCATCGCCGCTGTCTTCGCCAGTATC
TACTCCATGACGGCTGTGGCCTTTGATAGGTACATGGCCATCATACATCCCCTCCAGCCC
CGGCTGTCAGCCACAGCCACCAAAGTGGTCATCTGTGTCATCTGGGTCCTGGCTCTCCTG
CTGGCCTTCCCCCAGGGCTACTACTCAACCACAGAGACCATGCCCAGCAGAGTCGTGTGC
ATGATCGAATGGCCAGAGCATCCGAACAAGATTTATGAGAAAGTGTACCACATCTGTGTG
ACTGTGCTGATCTACTTCCTCCCCCTGCTGGTGATTGGCTATGCATACACCGTAGTGGGA
ATCACACTATGGGCCAGTGAGATCCCCGGGGACTCCTCTGACCGCTACCACGAGCAAGTC
TCTGCCAAGCGCAAGGTGGTCAAAATGATGATTGTCGTGGTGTGCACCTTCGCCATCTGC
TGGCTGCCCTTCCACATCTTCTTCCTCCTGCCCTACATCAACCCAGATCTCTACCTGAAG
AAGTTTATCCAGCAGGTCTACCTGGCCATCATGTGGCTGGCCATGAGCTCCACCATGTAC
AACCCCATCATCTACTGCTGCCTCAATGACAGGTTCCGTCTGGGCTTCAAGCATGCCTTC
CGGTGCTGCCCCTTCATCAGCGCCGGCGACTATGAGGGGCTGGAAATGAAATCCACCCGG
TATCTCCAGACCCAGGGCAGTGTGTACAAAGTCAGCCGCCTGGAGACCACCATCTCCACA
GTGGTGGGGGCCCACGAGGAGGAGCCAGAGGACGGCCCCAAGGCCACACCCTCGTCCCTG
GACCTGACCTCCAACTGCTCTTCACGAAGTGACTCCAAGACCATGACAGAGAGCTTCAGC
TTCTCCTCCAATGTGCTCTCCTAG
Protein Properties
Number of Residues 407
Molecular Weight 46250.5
Theoretical pI 7.22
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 32-54
  • 65-86
  • 107-128
  • 149-169
  • 195-219
  • 249-270
  • 284-308
Protein Sequence
>Substance-P receptor
MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAH
KRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASI
YSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVC
MIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMY
NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTIST
VVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P25103
UniProtKB/Swiss-Prot Entry Name NK1R_HUMAN
PDB IDs Not Available
GenBank Gene ID S62045
GeneCard ID TACR1
GenAtlas ID TACR1
HGNC ID HGNC:11526
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Takeda Y, Chou KB, Takeda J, Sachais BS, Krause JE: Molecular cloning, structural characterization and functional expression of the human substance P receptor. Biochem Biophys Res Commun. 1991 Sep 30;179(3):1232-40. [PubMed:1718267 ]
  4. Hopkins B, Powell SJ, Danks P, Briggs I, Graham A: Isolation and characterisation of the human lung NK-1 receptor cDNA. Biochem Biophys Res Commun. 1991 Oct 31;180(2):1110-7. [PubMed:1659396 ]
  5. Gerard NP, Garraway LA, Eddy RL Jr, Shows TB, Iijima H, Paquet JL, Gerard C: Human substance P receptor (NK-1): organization of the gene, chromosome localization, and functional expression of cDNA clones. Biochemistry. 1991 Nov 5;30(44):10640-6. [PubMed:1657150 ]
  6. Takahashi K, Tanaka A, Hara M, Nakanishi S: The primary structure and gene organization of human substance P and neuromedin K receptors. Eur J Biochem. 1992 Mar 15;204(3):1025-33. [PubMed:1312928 ]
  7. Fong TM, Anderson SA, Yu H, Huang RR, Strader CD: Differential activation of intracellular effector by two isoforms of human neurokinin-1 receptor. Mol Pharmacol. 1992 Jan;41(1):24-30. [PubMed:1310144 ]
  8. Page NM, Bell NJ: The human tachykinin NK1 (short form) and tachykinin NK4 receptor: a reappraisal. Eur J Pharmacol. 2002 Feb 15;437(1-2):27-30. [PubMed:11864635 ]
  9. Fong TM, Cascieri MA, Yu H, Bansal A, Swain C, Strader CD: Amino-aromatic interaction between histidine 197 of the neurokinin-1 receptor and CP 96345. Nature. 1993 Mar 25;362(6418):350-3. [PubMed:8384323 ]
  10. Randolph GP, Simon JS, Arreaza MG, Qiu P, Lachowicz JE, Duffy RA: Identification of single-nucleotide polymorphisms of the human neurokinin 1 receptor gene and pharmacological characterization of a Y192H variant. Pharmacogenomics J. 2004;4(6):394-402. [PubMed:15452552 ]