You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07843
Secondary Accession Numbers
  • 13552
Name Substance-K receptor
Synonyms
  1. NK-2 receptor
  2. NK-2R
  3. Neurokinin A receptor
  4. SKR
  5. Tachykinin receptor 2
Gene Name TACR2
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function This is a receptor for the tachykinin neuropeptide substance K (neurokinin A). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is:substance K > neuromedin-K > substance P
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
plasma membrane
intrinsic to membrane
integral to membrane
Function
neuropeptide receptor activity
tachykinin receptor activity
receptor activity
molecular transducer activity
signal transducer activity
peptide receptor activity
peptide receptor activity, g-protein coupled
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 10q11-q21
SNPs TACR2
Gene Sequence
>1197 bp
ATGGGGACCTGTGACATTGTGACTGAAGCCAATATCTCATCTGGCCCTGAGAGCAACACC
ACGGGCATCACAGCCTTCTCCATGCCCAGCTGGCAACTGGCACTGTGGGCCACAGCCTAC
CTGGCCCTGGTGCTGGTGGCCGTGACGGGTAATGCCATCGTCATCTGGATCATCCTGGCC
CATCGGAGGATGCGCACAGTCACCAACTACTTCATCGTCAATCTGGCGCTGGCTGACCTC
TGCATGGCTGCCTTCAATGCCGCCTTCAACTTTGTCTATGCCAGCCACAACATCTGGTAC
TTTGGCCGTGCCTTCTGCTACTTCCAGAACCTCTTCCCCATCACAGCCATGTTTGTCAGC
ATCTACTCCATGACCGCCATTGCTGCCGACAGGTACATGGCCATCGTCCACCCCTTCCAG
CCTCGGCTTTCAGCTCCCAGCACCAAGGCGGTTATTGCTGGCATCTGGCTGGTGGCTCTC
GCCCTGGCCTCCCCTCAGTGCTTCTACTCCACCGTCACCATGGACCAGGGTGCCACCAAG
TGCGTGGTGGCCTGGCCCGAAGACAGCGGGGGCAAGACGCTCCTCCTGTACCACCTCGTG
GTGATCGCCCTCATCTACTTCCTGCCGCTCGCGGTGATGTTTGTAGCCTACAGCGTCATC
GGCCTCACGCTCTGGAGGCGCGCAGTGCCCGGACATCAGGCGCACGGTGCCAACCTGCGC
CACCTGCAGGCCATGAAGAAGTTTGTGAAGACCATGGTGCTGGTGGTGCTGACGTTTGCC
ATCTGCTGGCTGCCCTACCACCTCTACTTCATCCTGGGCAGCTTCCAGGAGGACATCTAC
TGCCACAAGTTCATCCAGCAAGTCTACCTGGCACTCTTCTGGTTGGCCATGAGCTCTACC
ATGTACAATCCCATCATCTACTGCTGTCTCAACCACAGGTTTCGCTCTGGATTCCGGCTT
GCCTTCCGCTGCTGCCCATGGGTCACACCCACCAAGGAAGATAAGCTCGAGCTGACTCCC
ACGACCTCCCTCTCCACGAGAGTCAACAGGTGTCACACTAAGGAGACTTTGTTCATGGCT
GGGGACACAGCCCCCTCCGAGGCTACCAGTGGGGAGGCGGGGCGTCCCCAGGATGGATCA
GGGCTATGGTTTGGGTATGGTTTGCTTGCCCCCACCAAAACTCATGTTGAAATTTGA
Protein Properties
Number of Residues 398
Molecular Weight 44441.7
Theoretical pI 8.63
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 33-56
  • 70-90
  • 108-129
  • 150-170
  • 197-218
  • 252-272
  • 291-310
Protein Sequence
>Substance-K receptor
MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILA
HRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS
IYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATK
CVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLR
HLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSST
MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMA
GDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI
GenBank ID Protein 21928731
UniProtKB/Swiss-Prot ID P21452
UniProtKB/Swiss-Prot Entry Name NK2R_HUMAN
PDB IDs Not Available
GenBank Gene ID AB065731
GeneCard ID TACR2
GenAtlas ID TACR2
HGNC ID HGNC:11527
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gerard NP, Eddy RL Jr, Shows TB, Gerard C: The human neurokinin A (substance K) receptor. Molecular cloning of the gene, chromosome localization, and isolation of cDNA from tracheal and gastric tissues. J Biol Chem. 1990 Nov 25;265(33):20455-62. [PubMed:2173708 ]
  4. Gerard NP, Eddy RL Jr, Shows TB, Gerard C: The human neurokinin A (substance K) receptor. Molecular cloning of the gene, chromosome localization, and isolation of the cDNA from tracheal and gastric tissues. J Biol Chem. 1991 Jan 15;266(2):1354. [PubMed:1845990 ]
  5. Gerard NP, Gerard C: Molecular cloning of the human neurokinin-2 receptor cDNA by polymerase chain reaction and isolation of the gene. Ann N Y Acad Sci. 1991;632:389-90. [PubMed:1659296 ]
  6. Cyr C, South V, Saltzman A, Felder S, Ricca GA, Jaye M, Huebner K, Kagan J, Croce CM, Schlessinger J, et al.: Cloning, expression of the human substance K receptor, and analysis of its role in mitogenesis. Ann N Y Acad Sci. 1991;632:426-7. [PubMed:1659297 ]
  7. Graham A, Hopkins B, Powell SJ, Danks P, Briggs I: Isolation and characterisation of the human lung NK-2 receptor gene using rapid amplification of cDNA ends. Biochem Biophys Res Commun. 1991 May 31;177(1):8-16. [PubMed:1710456 ]
  8. Kris RM, South V, Saltzman A, Felder S, Ricca GA, Jaye M, Huebner K, Kagan J, Croce CM, Schlessinger J: Cloning and expression of the human substance K receptor and analysis of its role in mitogenesis. Cell Growth Differ. 1991 Jan;2(1):15-22. [PubMed:1848773 ]