Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07847
Secondary Accession Numbers
  • 13556
Name Neuropeptide FF receptor 1
Synonyms
  1. G-protein coupled receptor 147
  2. RFamide-related peptide receptor OT7T022
Gene Name NPFFR1
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Receptor for NPAF (A-18-F-amide) and NPFF (F-8-F-amide) neuropeptides, also known as morphine-modulating peptides. Can also be activated by a variety of naturally occurring or synthetic FMRF-amide like ligands. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol- calcium second messenger system
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
neuropeptide receptor activity
receptor activity
molecular transducer activity
signal transducer activity
peptide receptor activity
peptide receptor activity, g-protein coupled
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 10q21-q22
SNPs NPFFR1
Gene Sequence
>1293 bp
ATGGAGGGGGAGCCCTCCCAGCCTCCCAACAGCAGTTGGCCCCTAAGTCAGAATGGGACT
AACACTGAGGCCACCCCGGCTACAAACCTCACCTTCTCCTCCTACTATCAGCACACCTCC
CCTGTGGCGGCCATGTTCATTGTGGCCTATGCGCTCATCTTCCTGCTCTGCATGGTGGGC
AACACCCTGGTCTGTTTCATCGTGCTCAAGAACCGGCACATGCATACTGTCACCAACATG
TTCATCCTCAACCTGGCTGTCAGTGACCTGCTGGTGGGCATCTTCTGCATGCCCACCACC
CTTGTGGACAACCTCATCACTGGGTGGCCCTTCGACAATGCCACATGCAAGATGAGCGGC
TTGGTGCAGGGCATGTCTGTGTCGGCTTCCGTTTTCACACTGGTGGCCATTGCTGTGGAA
AGGTTCCGCTGCATCGTGCACCCTTTCCGCGAGAAGCTGACCCTGCGGAAGGCGCTCGTC
ACCATCGCCGTCATCTGGGCCCTGGCGCTGCTCATCATGTGTCCCTCGGCCGTCACGCTG
ACCGTCACCCGTGAGGAGCACCACTTCATGGTGGACGCCCGCAACCGCTCCTACCCTCTC
TACTCCTGCTGGGAGGCCTGGCCCGAGAAGGGCATGCGCAGGGTCTACACCACTGTGCTC
TTCTCGCACATCTACCTGGCGCCGCTGGCGCTCATCGTGGTCATGTACGCCCGCATCGCG
CGCAAGCTCTGCCAGGCCCCGGGCCCGGCCCCCGGGGGCGAGGAGGCTGCGGACCCGCGA
GCATCGCGGCGCAGAGCGCGCGTGGTGCACATGCTGGTCATGGTGGCGCTGTTCTTCACG
CTGTCCTGGCTGCCGCTCTGGGCGCTGCTGCTGCTCATCGACTACGGGCAGCTCAGCGCG
CCGCAGCTGCACCTGGTCACCGTCTACGCCTTCCCCTTCGCGCACTGGCTGGCCTTCTTC
AACAGCAGCGCCAACCCCATCATCTACGGCTACTTCAACGAGAACTTCCGCCGCGGCTTC
CAGGCCGCCTTCCGCGCCCGCCTCTGCCCGCGCCCGTCGGGGAGCCACAAGGAGGCCTAC
TCCGAGCGGCCCGGCGGGCTTCTGCACAGGCGGGTCTTCGTGGTGGTGCGGCCCAGCGAC
TCCGGGCTGCCCTCTGAGTCGGGCCCTAGCAGTGGGGCCCCCAGGCCCGGCCGCCTCCCG
CTGCGGAATGGGCGGGTGGCTCACCACGGCTTGCCCAGGGAAGGGCCTGGCTGCTCCCAC
CTGCCCCTCACCATTCCAGCCTGGGATATCTGA
Protein Properties
Number of Residues 430
Molecular Weight 47818.4
Theoretical pI 9.63
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 44-64
  • 81-101
  • 118-138
  • 159-179
  • 215-235
  • 272-292
  • 308-328
Protein Sequence
>Neuropeptide FF receptor 1
MEGEPSQPPNSSWPLSQNGTNTEATPATNLTFSSYYQHTSPVAAMFIVAYALIFLLCMVG
NTLVCFIVLKNRHMHTVTNMFILNLAVSDLLVGIFCMPTTLVDNLITGWPFDNATCKMSG
LVQGMSVSASVFTLVAIAVERFRCIVHPFREKLTLRKALVTIAVIWALALLIMCPSAVTL
TVTREEHHFMVDARNRSYPLYSCWEAWPEKGMRRVYTTVLFSHIYLAPLALIVVMYARIA
RKLCQAPGPAPGGEEAADPRASRRRARVVHMLVMVALFFTLSWLPLWALLLLIDYGQLSA
PQLHLVTVYAFPFAHWLAFFNSSANPIIYGYFNENFRRGFQAAFRARLCPRPSGSHKEAY
SERPGGLLHRRVFVVVRPSDSGLPSESGPSSGAPRPGRLPLRNGRVAHHGLPREGPGCSH
LPLTIPAWDI
GenBank ID Protein 11125702
UniProtKB/Swiss-Prot ID Q9GZQ6
UniProtKB/Swiss-Prot Entry Name NPFF1_HUMAN
PDB IDs Not Available
GenBank Gene ID AB040104
GeneCard ID NPFFR1
GenAtlas ID NPFFR1
HGNC ID HGNC:17425
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  3. Bonini JA, Jones KA, Adham N, Forray C, Artymyshyn R, Durkin MM, Smith KE, Tamm JA, Boteju LW, Lakhlani PP, Raddatz R, Yao WJ, Ogozalek KL, Boyle N, Kouranova EV, Quan Y, Vaysse PJ, Wetzel JM, Branchek TA, Gerald C, Borowsky B: Identification and characterization of two G protein-coupled receptors for neuropeptide FF. J Biol Chem. 2000 Dec 15;275(50):39324-31. [PubMed:11024015 ]
  4. Hinuma S, Shintani Y, Fukusumi S, Iijima N, Matsumoto Y, Hosoya M, Fujii R, Watanabe T, Kikuchi K, Terao Y, Yano T, Yamamoto T, Kawamata Y, Habata Y, Asada M, Kitada C, Kurokawa T, Onda H, Nishimura O, Tanaka M, Ibata Y, Fujino M: New neuropeptides containing carboxy-terminal RFamide and their receptor in mammals. Nat Cell Biol. 2000 Oct;2(10):703-8. [PubMed:11025660 ]