Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07848
Secondary Accession Numbers
  • 13557
Name Neuropeptide FF receptor 2
Synonyms
  1. G-protein coupled receptor 74
  2. G-protein coupled receptor HLWAR77
  3. Neuropeptide G-protein coupled receptor
Gene Name NPFFR2
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Receptor for NPAF (A-18-F-amide) and NPFF (F-8-F-amide) neuropeptides, also known as morphine-modulating peptides. Can also be activated by a variety of naturally occurring or synthetic FMRF-amide like ligands. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol- calcium second messenger system
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
neuropeptide receptor activity
receptor activity
molecular transducer activity
signal transducer activity
peptide receptor activity
peptide receptor activity, g-protein coupled
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:4
Locus 4q21
SNPs NPFFR2
Gene Sequence
>1569 bp
ATGAATAGCTTCTTCGGAACCCCAGCGGCCAGCTGGTGCCTCCTGGAAAGTGACGTCTCA
TCTGCACCGGACAAGGAGGCGGGGAGGGAGCGCAGAGCACTCAGCGTCCAGCAGCGCGGC
GGGCCAGCCTGGAGCGGAAGCCTGGAGTGGAGCAGGCAGTCCGCGGGGGACAGACGTCGG
CTGGGATTGAGCCGGCAGACTGCGAAAAGTAGCTGGAGCCGGAGCAGGGACAGAACCTGT
TGCTGCAGACGGGCTTGGTGGATTCTGGTTCCTGCCGCCGACAGGGCTCGCCGGGAGAGG
TTCATCATGAATGAGAAATGGGACACAAACTCTTCAGAAAACTGGCATCCCATCTGGAAT
GTCAATGACACAAAGCATCATCTGTACTCAGATATTAATATTACCTATGTGAACTACTAT
CTTCACCAGCCTCAAGTGGCAGCAATCTTCATTATTTCCTACTTTCTGATCTTCTTTTTG
TGCATGATGGGAAATACTGTGGTTTGCTTTATTGTAATGAGGAACAAACATATGCACACA
GTCACTAATCTCTTCATCTTAAACCTGGCCATAAGTGATTTACTAGTTGGCATATTCTGC
ATGCCTATAACACTGCTGGACAATATTATAGCAGGATGGCCATTTGGAAACACGATGTGC
AAGATCAGTGGATTGGTCCAGGGAATATCTGTCGCAGCTTCAGTCTTTACGTTAGTTGCA
ATTGCTGTAGATAGGTTCCAGTGTGTGGTCTACCCTTTTAAACCAAAGCTCACTATCAAG
ACAGCGTTTGTCATTATTATGATCATCTGGGTCCTAGCCATCACCATTATGTCTCCATCT
GCAGTAATGTTACATGTGCAAGAAGAAAAATATTACCGAGTGAGACTCAACTCCCAGAAT
AAAACCAGTCCAGTCTACTGGTGCCGGGAAGACTGGCCAAATCAGGAAATGAGGAAGATC
TACACCACTGTGCTGTTTGCCAACATCTACCTGGCTCCCCTCTCCCTCATTGTCATCATG
TATGGAAGGATTGGAATTTCACTCTTCAGGGCTGCAGTTCCTCACACAGGCAGGAAGAAC
CAGGAGCAGTGGCACGTGGTGTCCAGGAAAAAGCAGAAGATCATTAAGATGCTCCTGATT
GTGGCCCTGCTTTTTATTCTCTCATGGCTGCCCCTGTGGACTCTAATGATGCTCTCAGAC
TACGCTGACCTTTCTCCAAATGAACTGCAGATCATCAACATCTACATCTACCCTTTTGCA
CACTGGCTGGCATTCGGCAACAGCAGTGTCAATCCCATCATTTATGGTTTCTTCAACGAG
AATTTCCGCCGTGGTTTCCAAGAAGCTTTCCAGCTCCAGCTCTGCCAAAAAAGAGCAAAG
CCTATGGAAGCTTATACCCTAAAAGCTAAAAGCCATGTGCTCATAAACACATCTAATCAG
CTTGTCCAGGAATCTACATTTCAAAACCCTCATGGGGAAACCTTGCTTTATAGGAAAAGT
GCTGAAAAACCCCAACAGGAATTAGTGATGGAAGAATTAAAAGAAACTACTAACAGCAGT
GAGATTTAA
Protein Properties
Number of Residues 522
Molecular Weight 60269.7
Theoretical pI 9.69
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 148-168
  • 185-205
  • 222-242
  • 263-283
  • 320-340
  • 378-398
  • 414-434
Protein Sequence
>Neuropeptide FF receptor 2
MNSFFGTPAASWCLLESDVSSAPDKEAGRERRALSVQQRGGPAWSGSLEWSRQSAGDRRR
LGLSRQTAKSSWSRSRDRTCCCRRAWWILVPAADRARRERFIMNEKWDTNSSENWHPIWN
VNDTKHHLYSDINITYVNYYLHQPQVAAIFIISYFLIFFLCMMGNTVVCFIVMRNKHMHT
VTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVA
IAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQN
KTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHTGRKN
QEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFA
HWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPMEAYALKAKSHVLINTSNQ
LVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETTNSSEI
GenBank ID Protein 4530469
UniProtKB/Swiss-Prot ID Q9Y5X5
UniProtKB/Swiss-Prot Entry Name NPFF2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF119815
GeneCard ID NPFFR2
GenAtlas ID NPFFR2
HGNC ID HGNC:4525
References
General References
  1. Bonini JA, Jones KA, Adham N, Forray C, Artymyshyn R, Durkin MM, Smith KE, Tamm JA, Boteju LW, Lakhlani PP, Raddatz R, Yao WJ, Ogozalek KL, Boyle N, Kouranova EV, Quan Y, Vaysse PJ, Wetzel JM, Branchek TA, Gerald C, Borowsky B: Identification and characterization of two G protein-coupled receptors for neuropeptide FF. J Biol Chem. 2000 Dec 15;275(50):39324-31. [PubMed:11024015 ]
  2. Cikos S, Gregor P, Koppel J: Sequence and tissue distribution of a novel G-protein-coupled receptor expressed prominently in human placenta. Biochem Biophys Res Commun. 1999 Mar 16;256(2):352-6. [PubMed:10079187 ]
  3. Elshourbagy NA, Ames RS, Fitzgerald LR, Foley JJ, Chambers JK, Szekeres PG, Evans NA, Schmidt DB, Buckley PT, Dytko GM, Murdock PR, Milligan G, Groarke DA, Tan KB, Shabon U, Nuthulaganti P, Wang DY, Wilson S, Bergsma DJ, Sarau HM: Receptor for the pain modulatory neuropeptides FF and AF is an orphan G protein-coupled receptor. J Biol Chem. 2000 Aug 25;275(34):25965-71. [PubMed:10851242 ]
  4. Parker RM, Copeland NG, Eyre HJ, Liu M, Gilbert DJ, Crawford J, Couzens M, Sutherland GR, Jenkins NA, Herzog H: Molecular cloning and characterisation of GPR74 a novel G-protein coupled receptor closest related to the Y-receptor family. Brain Res Mol Brain Res. 2000 May 5;77(2):199-208. [PubMed:10837915 ]