Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07855
Secondary Accession Numbers
  • 13564
Name Nucleobindin-1
Synonyms
  1. CALNUC
Gene Name NUCB1
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Major calcium-binding protein of the Golgi. May have a role in calcium homeostasis
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Cellular Location
  1. Cytoplasm
  2. Peripheral membrane protein
  3. Golgi apparatus
  4. Lumenal side
  5. cis-Golgi network membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.33
SNPs NUCB1
Gene Sequence
>1386 bp
ATGCCTCCCTCTGGGCCCCGAGGAACCCTCCTTCTGTTGCCGCTGCTGCTGCTGCTCCTG
CTTCGCGCCGTGCTGGCTGTCCCCCTGGAGCGAGGGGCGCCCAACAAGGAGGAGACCCCT
GCGACTGAGAGTCCCGACACAGGCCTGTACTACCACCGGTACCTCCAGGAGGTCATCGAT
GTACTGGAGACGGATGGGCATTTCCGAGAGAAGCTGCAGGCTGCCAATGCGGAGGACATC
AAGAGCGGGAAGCTGAGCCGAGAGCTGGACTTTGTCAGCCACCACGTCCGCACCAAGCTG
GATGAGCTCAAGCGACAGGAGGTGTCACGGCTGCGGATGCTGCTCAAGGCCAAGATGGAC
GCCGAGCAGGATCCCAATGTACAGGTGGATCATCTGAATCTCCTGAAACAGTTTGAACAC
CTGGACCCTCAGAACCAGCATACATTCGAGGCCCGCGACCTGGAGCTGCTGATCCAGACG
GCCACCCGGGACCTTGCCCAGTACGACGCAGCCCATCATGAAGAGTTCAAGCGCTACGAG
ATGCTTAAGGAACACGAGAGACGGCGTTATCTGGAGTCACTGGGAGAGGAGCAGAGAAAG
GAGGCGGAGAGGAAGCTGGAAGAGCAACAGCGCCGGCACCGCGAGCACCCTAAAGTCAAC
GTGCCTGGCAGCCAAGCCCAGTTGAAGGAGGTGTGGGAGGAGCTGGATGGACTGGACCCC
AACAGGTTTAACCCCAAGACCTTCTTCATACTGCATGATATCAACAGTGATGGTGTCCTG
GATGAGCAGGAGCTGGAGGCACTCTTCACCAAGGAGCTGGAGAAAGTGTACGACCCAAAG
AATGAGGAGGACGACATGCGGGAGATGGAGGAGGAGCGACTGCGCATGCGGGAGCATGTG
ATGAAGAATGTGGACACCAACCAGGACCGCCTCGTGACCCTGGAGGAGTTCCTCGCATCC
ACTCAGAGGAAGGAGTTTGGGGACACCGGGGAGGGCTGGGAGACAGTGGAGATGCACCCT
GCCTACACCGAGGAAGAGCTGAGGCGCTTTGAAGAGGAGCTGGCTGCCCGGGAGGCAGAG
CTGAATGCCAAGGCCCAGCGCCTCAGCCAGGAGACAGAGGCTCTAGGGCGGTCCCAGGGC
CGCCTGGAGGCCCAGAAGAGAGAGCTGCAGCAGGCTGTGCTGCACATGGAGCAGCGGAAG
CAGCAGCAGCAGCAGCAGCAAGGCCACAAGGCCCCGGCTGCCCACCCTGAGGGGCAGCTC
AAGTTCCACCCAGACACAGACGATGTACCTGTCCCAGCTCCAGCCGGTGACCAGAAGGAG
GTGGACACTTCAGAAAAGAAACTTCTCGAGCGGCTCCCTGAGGTTGAGGTGCCCCAGCAT
CTGTGA
Protein Properties
Number of Residues 461
Molecular Weight 53879.0
Theoretical pI 4.92
Pfam Domain Function Not Available
Signals
  • 1-26
Transmembrane Regions
  • None
Protein Sequence
>Nucleobindin-1
MPPSGPRGTLLLLPLLLLLLLRAVLAVPLERGAPNKEETPATESPDTGLYYHRYLQEVID
VLETDGHFREKLQAANAEDIKSGKLSRELDFVSHHVRTKLDELKRQEVSRLRMLLKAKMD
AEQDPNVQVDHLNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYE
MLKEHERRRYLESLGEEQRKEAERKLEEQQRRHREHPKVNVPGSQAQLKEVWEELDGLDP
NRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHV
MKNVDTNQDRLVTLEEFLASTQRKEFGDTGEGWETVEMHPAYTEEELRRFEEELAAREAE
LNAKAQRLSQETEALGRSQGRLEAQKRELQQAVLHMEQRKQQQQQQQGHKAPAAHPEGQL
KFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL
GenBank ID Protein 189067873
UniProtKB/Swiss-Prot ID Q02818
UniProtKB/Swiss-Prot Entry Name NUCB1_HUMAN
PDB IDs
GenBank Gene ID AK315422
GeneCard ID NUCB1
GenAtlas ID NUCB1
HGNC ID HGNC:8043
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  4. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  5. Miura K, Titani K, Kurosawa Y, Kanai Y: Molecular cloning of nucleobindin, a novel DNA-binding protein that contains both a signal peptide and a leucine zipper structure. Biochem Biophys Res Commun. 1992 Aug 31;187(1):375-80. [PubMed:1520323 ]
  6. Miura K, Hirai M, Kanai Y, Kurosawa Y: Organization of the human gene for nucleobindin (NUC) and its chromosomal assignment to 19q13.2-q13.4. Genomics. 1996 Jun 1;34(2):181-6. [PubMed:8661046 ]
  7. Mochizuki N, Hibi M, Kanai Y, Insel PA: Interaction of the protein nucleobindin with G alpha i2, as revealed by the yeast two-hybrid system. FEBS Lett. 1995 Oct 9;373(2):155-8. [PubMed:7589456 ]
  8. de Alba E, Tjandra N: Structural studies on the Ca2+-binding domain of human nucleobindin (calnuc). Biochemistry. 2004 Aug 10;43(31):10039-49. [PubMed:15287731 ]