You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07859
Secondary Accession Numbers
  • 13569
Name P2X purinoceptor 1
Synonyms
  1. ATP receptor
  2. P2X1
  3. Purinergic receptor
Gene Name P2RX1
Protein Type Unknown
Biological Properties
General Function Involved in receptor activity
Specific Function Ligand-gated ion channel with relatively high calcium permeability. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Seems to be linked to apoptosis, by increasing the intracellular concentration of calcium in the presence of ATP, leading to programmed cell death
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
receptor activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
molecular transducer activity
signal transducer activity
transporter activity
ion channel activity
Process
establishment of localization
transport
ion transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 17p13.3
SNPs P2RX1
Gene Sequence
>1200 bp
ATGGCACGGCGGTTCCAGGAGGAGCTGGCCGCCTTCCTCTTCGAGTATGACACCCCCCGC
ATGGTGCTGGTGCGTAATAAGAAGGTGGGCGTTATCTTCCGACTGATCCAGCTGGTGGTC
CTGGTCTACGTCATCGGGTGGGTGTTTCTCTATGAGAAGGGCTACCAGACCTCGAGCGGC
CTCATCAGCAGTGTCTCTGTGAAACTCAAGGGCCTGGCCGTGACCCAGCTCCCTGGCCTC
GGCCCCCAGGTCTGGGATGTGGCTGACTACGTCTTCCCAGCCCAGGGGGACAACTCCTTC
GTGGTCATGACCAATTTCATCGTGACCCCGAAGCAGACTCAAGGCTACTGCGCAGAGCAC
CCAGAAGGGGGCATATGCAAGGAAGACAGTGGCTGTACCCCTGGGAAGGCCAAGAGGAAG
GCCCAAGGCATCCGCACGGGCAAGTGTGTGGCCTTCAACGACACTGTGAAGACGTGTGAG
ATCTTTGGCTGGTGCCCCGTGGAGGTGGATGACGACATCCCGCGCCCTGCCCTTCTCCGA
GAGGCCGAGAACTTCACTCTTTTCATCAAGAACAGCATCAGCTTTCCACGCTTCAAGGTC
AACAGGCGCAACCTGGTGGAGGAGGTGAATGCTGCCCACATGAAGACCTGCCTCTTTCAC
AAGACCCTGCACCCCCTGTGCCCAGTCTTCCAGCTTGGCTACGTGGTGCAAGAGTCAGGC
CAGAACTTCAGCACCCTGGCTGAGAAGGGTGGAGTGGTTGGCATCACCATCGACTGGCAC
TGTGACCTGGACTGGCACGTACGGCACTGCAGACCCATCTATGAGTTCCATGGGCTGTAC
GAAGAGAAAAATCTCTCCCCAGGCTTCAACTTCAGGTTTGCCAGGCACTTTGTGGAGAAC
GGGACCAACTACCGTCACCTCTTCAAGGTGTTTGGGATTCGCTTTGACATCCTGGTGGAC
GGCAAGGCCGGGAAGTTTGACATCATCCCTACAATGACCACCATCGGCTCTGGAATTGGC
ATCTTTGGGGTGGCCACAGTTCTCTGTGACCTGCTGCTGCTTCACATCCTGCCTAAGAGG
CACTACTACAAGCAGAAGAAGTTCAAATACGCTGAGGACATGGGGCCAGGGGCGGCTGAG
CGTGACCTCGCAGCTACCAGCTCCACCCTGGGCCTGCAGGAGAACATGAGGACATCCTGA
Protein Properties
Number of Residues 399
Molecular Weight 44979.8
Theoretical pI 8.59
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 29-50
  • 339-358
Protein Sequence
>P2X purinoceptor 1
MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFLYEKGYQTSSG
LISSVSVKLKGLAVTQLPGLGPQVWDVADYVFPAQGDNSFVVMTNFIVTPKQTQGYCAEH
PEGGICKEDSGCTPGKAKRKAQGIRTGKCVAFNDTVKTCEIFGWCPVEVDDDIPRPALLR
EAENFTLFIKNSISFPRFKVNRRNLVEEVNAAHMKTCLFHKTLHPLCPVFQLGYVVQESG
QNFSTLAEKGGVVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVEN
GTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKR
HYYKQKKFKYAEDMGPGAAERDLAATSSTLGLQENMRTS
GenBank ID Protein 3258623
UniProtKB/Swiss-Prot ID P51575
UniProtKB/Swiss-Prot Entry Name P2RX1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF020498
GeneCard ID P2RX1
GenAtlas ID P2RX1
HGNC ID HGNC:8533
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Valera S, Talabot F, Evans RJ, Gos A, Antonarakis SE, Morris MA, Buell GN: Characterization and chromosomal localization of a human P2X receptor from the urinary bladder. Receptors Channels. 1995;3(4):283-9. [PubMed:8834001 ]
  3. Longhurst PA, Schwegel T, Folander K, Swanson R: The human P2x1 receptor: molecular cloning, tissue distribution, and localization to chromosome 17. Biochim Biophys Acta. 1996 Sep 11;1308(3):185-8. [PubMed:8809107 ]
  4. Sun B, Li J, Okahara K, Kambayashi J: P2X1 purinoceptor in human platelets. Molecular cloning and functional characterization after heterologous expression. J Biol Chem. 1998 May 8;273(19):11544-7. [PubMed:9565569 ]
  5. Ennion SJ, Evans RJ: Conserved cysteine residues in the extracellular loop of the human P2X(1) receptor form disulfide bonds and are involved in receptor trafficking to the cell surface. Mol Pharmacol. 2002 Feb;61(2):303-11. [PubMed:11809854 ]
  6. Oury C, Toth-Zsamboki E, Van Geet C, Thys C, Wei L, Nilius B, Vermylen J, Hoylaerts MF: A natural dominant negative P2X1 receptor due to deletion of a single amino acid residue. J Biol Chem. 2000 Jul 28;275(30):22611-4. [PubMed:10816552 ]