You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07861
Secondary Accession Numbers
  • 13571
Name P2Y purinoceptor 6
Synonyms
  1. P2Y6
Gene Name P2RY6
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Receptor for extracellular UDP > UTP > ATP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
nucleotide receptor activity, g-protein coupled
purinergic nucleotide receptor activity, g-protein coupled
receptor activity
transmembrane receptor activity
molecular transducer activity
signal transducer activity
g-protein coupled receptor activity
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 11q13.5
SNPs P2RY6
Gene Sequence
>987 bp
ATGGAATGGGACAATGGCACAGGCCAGGCTCTGGGCTTGCCACCCACCACCTGTGTCTAC
CGCGAGAACTTCAAGCAACTGCTGCTGCCACCTGTGTATTCGGCGGTGCTGGCGGCTGGC
CTGCCGCTGAACATCTGTGTCATTACCCAGATCTGCACGTCCCGCCGGGCCCTGACCCGC
ACGGCCGTGTACACCCTAAACCTTGCTCTGGCTGACCTGCTATATGCCTGCTCCCTGCCC
CTGCTCATCTACAACTATGCCCAAGGTGATCACTGGCCCTTTGGCGACTTCGCCTGCCGC
CTGGTCCGCTTCCTCTTCTATGCCAACCTGCACGGCAGCATCCTCTTCCTCACCTGCATC
AGCTTCCAGCGCTACCTGGGCATCTGCCACCCGCTGGCCCCCTGGCACAAACGTGGGGGC
CGCCGGGCTGCCTGGCTAGTGTGTGTAGCCGTGTGGCTGGCCGTGACAACCCAGTGCCTG
CCCACAGCCATCTTCGCTGCCACAGGCATCCAGCGTAACCGCACTGTCTGCTATGACCTC
AGCCCGCCTGCCCTGGCCACCCACTATATGCCCTATGGCATGGCTCTCACTGTCATCGGC
TTCCTGCTGCCCTTTGCTGCCCTGCTGGCCTGCTACTGTCTCCTGGCCTGCCGCCTGTGC
CGCCAGGATGGCCCGGCAGAGCCTGTGGCCCAGGAGCGGCGTGGCAAGGCGGCCCGCATG
GCCGTGGTGGTGGCTGCTGCCTTTGCCATCAGCTTCCTGCCTTTTCACATCACCAAGACA
GCCTACCTGGCAGTGCGCTCGACGCCGGGCGTCCCCTGCACTGTATTGGAGGCCTTTGCA
GCGGCCTACAAAGGCACGCGGCCGTTTGCCAGTGCCAACAGCGTGCTGGACCCCATCCTC
TTCTACTTCACCCAGAAGAAGTTCCGCCGGCGACCACATGAGCTCCTACAGAAACTCACA
GCCAAATGGCAGAGGCAGGGTCGCTGA
Protein Properties
Number of Residues 328
Molecular Weight 36428.5
Theoretical pI 9.7
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 28-48
  • 63-83
  • 102-122
  • 145-165
  • 195-215
  • 237-257
  • 281-303
Protein Sequence
>P2Y purinoceptor 6
MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTR
TAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCI
SFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDL
SPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARM
AVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPIL
FYFTQKKFRRRPHELLQKLTAKWQRQGR
GenBank ID Protein 2258420
UniProtKB/Swiss-Prot ID Q15077
UniProtKB/Swiss-Prot Entry Name P2RY6_HUMAN
PDB IDs Not Available
GenBank Gene ID AF007891
GeneCard ID P2RY6
GenAtlas ID P2RY6
HGNC ID HGNC:8543
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Wan D, Gong Y, Qin W, Zhang P, Li J, Wei L, Zhou X, Li H, Qiu X, Zhong F, He L, Yu J, Yao G, Jiang H, Qian L, Yu Y, Shu H, Chen X, Xu H, Guo M, Pan Z, Chen Y, Ge C, Yang S, Gu J: Large-scale cDNA transfection screening for genes related to cancer development and progression. Proc Natl Acad Sci U S A. 2004 Nov 2;101(44):15724-9. Epub 2004 Oct 21. [PubMed:15498874 ]
  3. Communi D, Parmentier M, Boeynaems JM: Cloning, functional expression and tissue distribution of the human P2Y6 receptor. Biochem Biophys Res Commun. 1996 May 15;222(2):303-8. [PubMed:8670200 ]
  4. Somers GR, Hammet F, Woollatt E, Richards RI, Southey MC, Venter DJ: Chromosomal localization of the human P2y6 purinoceptor gene and phylogenetic analysis of the P2y purinoceptor family. Genomics. 1997 Aug 15;44(1):127-30. [PubMed:9286708 ]
  5. Maier R, Glatz A, Mosbacher J, Bilbe G: Cloning of P2Y6 cDNAs and identification of a pseudogene: comparison of P2Y receptor subtype expression in bone and brain tissues. Biochem Biophys Res Commun. 1997 Aug 18;237(2):297-302. [PubMed:9268704 ]
  6. Maier R, Glatz A, Mosbacher J, Bilbe G: Cloning of P2Y6 cDNAs and identification of a pseudogene: comparison of P2Y receptor subtype expression in bone and brain tissues. Biochem Biophys Res Commun. 1997 Nov 17;240(2):298-302. [PubMed:9412455 ]