You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07862
Secondary Accession Numbers
  • 13572
Name P2Y purinoceptor 11
Synonyms
  1. P2Y11
Gene Name P2RY11
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Receptor for ATP and ADP coupled to G-proteins that activate both phosphatidylinositol-calcium and adenylyl cyclase second messenger systems. Not activated by UTP or UDP
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
nucleotide receptor activity, g-protein coupled
purinergic nucleotide receptor activity, g-protein coupled
receptor activity
transmembrane receptor activity
molecular transducer activity
signal transducer activity
g-protein coupled receptor activity
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.2
SNPs P2RY11
Gene Sequence
>1125 bp
ATGGCAGCCAACGTCTCGGGTGCCAAGTCCTGCCCTGCCAACTTCTTGGCAGCTGCCGAC
GACAAACTCAGTGGGTTCCAGGGGGACTTCCTGTGGCCCATACTGGTGGTTGAGTTCCTG
GTGGCCGTGGCCAGCAATGGCCTGGCCCTGTACCGCTTCAGCATCCGGAAGCAGCGCCCA
TGGCACCCCGCCGTGGTCTTCTCTGTCCAGCTGGCAGTCAGCGACCTGCTCTGCGCCCTG
ACGCTGCCCCCGCTGGCCGCCTACCTCTATCCCCCCAAGCACTGGCGCTATGGGGAGGCC
GCGTGCCGCCTGGAGCGCTTCCTCTTCACCTGCAACCTGCTGGGCAGCGTCATCTTCATC
ACCTGCATCAGCCTCAACCGCTACCTGGGCATCGTGCACCCCTTCTTCGCCCGAAGCCAC
CTGCGACCCAAGCACGCCTGGGCCGTGAGCGCTGCCGGCTGGGTCCTGGCCGCCCTGCTG
GCCATGCCCACACTCAGCTTCTCCCACCTGAAGAGGCCGCAGCAGGGGGCGGGCAACTGC
AGCGTGGCCAGGCCCGAGGCCTGCATCAAGTGTCTGGGGACAGCAGACCACGGGCTGGCG
GCCTACAGAGCGTATAGCCTGGTGCTGGCGGGGTTGGGCTGCGGCCTGCCGCTGCTGCTC
ACGCTGGCAGCCTACGGCGCCCTCGGGCGGGCCGTGCTACGCAGCCCAGGCATGACTGTG
GCCGAGAAGCTGCGTGTGGCAGCGTTGGTGGCCAGTGGTGTGGCCCTCTACGCCAGCTCC
TATGTGCCCTACCACATCATGCGGGTGCTCAACGTGGATGCTCGGCGGCGCTGGAGCACC
CGCTGCCCGAGCTTTGCAGACATAGCCCAGGCCACAGCAGCCCTGGAGCTGGGGCCCTAC
GTGGGCTACCAGGTGATGCGGGGCCTCATGCCCCTGGCCTTCTGTGTCCACCCTCTACTC
TACATGGCCGCAGTGCCCAGCCTGGGCTGCTGCTGCCGACACTGCCCCGGCTACAGGGAC
AGCTGGAACCCAGAGGACGCCAAGAGCACTGGCCAAGCCCTGCCCCTCAATGCCACAGCC
GCCCCTAAACCGTCAGAGCCCCAGTCCCGTGAGCTGAGCCAATGA
Protein Properties
Number of Residues 374
Molecular Weight 40344.8
Theoretical pI 9.28
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 30-50
  • 65-85
  • 117-137
  • 147-167
  • 207-227
  • 246-266
  • 309-329
Protein Sequence
>P2Y purinoceptor 11
MAANVSGAKSCPANFLAAADDKLSGFQGDFLWPILVVEFLVAVASNGLALYRFSIRKQRP
WHPAVVFSVQLAVSDLLCALTLPPLAAYLYPPKHWRYGEAACRLERFLFTCNLLGSVIFI
TCISLNRYLGIVHPFFARSHLRPKHAWAVSAAGWVLAALLAMPTLSFSHLKRPQQGAGNC
SVARPEACIKCLGTADHGLAAYRAYSLVLAGLGCGLPLLLTLAAYGALGRAVLRSPGMTV
AEKLRVAALVASGVALYASSYVPYHIMRVLNVDARRRWSTRCPSFADIAQATAALELGPY
VGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATA
APKPSEPQSRELSQ
GenBank ID Protein 23463303
UniProtKB/Swiss-Prot ID Q96G91
UniProtKB/Swiss-Prot Entry Name P2Y11_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_002566.4
GeneCard ID P2RY11
GenAtlas ID P2RY11
HGNC ID HGNC:8540
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Communi D, Govaerts C, Parmentier M, Boeynaems JM: Cloning of a human purinergic P2Y receptor coupled to phospholipase C and adenylyl cyclase. J Biol Chem. 1997 Dec 19;272(51):31969-73. [PubMed:9405388 ]
  4. Communi D, Suarez-Huerta N, Dussossoy D, Savi P, Boeynaems JM: Cotranscription and intergenic splicing of human P2Y11 and SSF1 genes. J Biol Chem. 2001 May 11;276(19):16561-6. Epub 2001 Feb 5. [PubMed:11278528 ]