Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07863
Secondary Accession Numbers
  • 13574
Name Cytosolic phospholipase A2 delta
Synonyms
  1. Phospholipase A2 group IVD
  2. cPLA2-delta
Gene Name PLA2G4D
Protein Type Unknown
Biological Properties
General Function Involved in metabolic process
Specific Function Calcium-dependent phospholipase A2 that selectively hydrolyzes glycerophospholipids in the sn-2 position. Not arachidonic acid-specific but has linoleic acid-specific activity. May play a role in inflammation in psoriatic lesions.
Pathways
  • alpha-Linolenic acid metabolism
  • Arachidonic acid metabolism
  • Ether lipid metabolism
  • Fc epsilon RI signaling pathway
  • Fc gamma R-mediated phagocytosis
  • Glutamatergic synapse
  • Glycerophospholipid metabolism
  • GnRH signaling pathway
  • Linoleic acid metabolism
  • Long-term depression
  • MAPK signaling pathway
  • Serotonergic synapse
  • Vascular smooth muscle contraction
  • VEGF signaling pathway
Reactions
Phosphatidylcholine + Water → 1-acylglycerophosphocholine + a carboxylate details
Phosphatidylcholine + Water → 1-Acyl-sn-glycero-3-phosphocholine + Fatty acid details
Phosphatidylcholine + Water → 1-Acyl-sn-glycero-3-phosphocholine + Arachidonic acid details
Phosphatidylethanolamine + Water → 1-Acyl-sn-glycero-3-phosphoethanolamine + Fatty acid details
Phosphatidylcholine + Water → 1-Acyl-sn-glycero-3-phosphocholine + Linoleic acid details
O-1-Alk-1-enyl-2-acyl-sn-glycero-3-phosphoethanolamine + Water → 1-(1-Alkenyl)-sn-glycero-3-phosphoethanolamine + Carboxylate details
1-Radyl-2-acyl-sn-glycero-3-phosphocholine + Water → 1-Organyl-2-lyso-sn-glycero-3-phosphocholine + Carboxylate details
Phosphatidylcholine + Water → 1-Acyl-sn-glycero-3-phosphocholine + alpha-Linolenic acid details
GO Classification
Biological Process
phosphatidylcholine acyl-chain remodeling
phosphatidylethanolamine acyl-chain remodeling
phosphatidylinositol acyl-chain remodeling
phosphatidylserine acyl-chain remodeling
phospholipid catabolic process
phosphatidic acid biosynthetic process
phosphatidylglycerol acyl-chain remodeling
Cellular Component
cytosol
cytoplasmic vesicle membrane
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
lipase activity
phospholipase activity
Molecular Function
phospholipase A2 activity
metal ion binding
Process
metabolic process
organophosphate metabolic process
phospholipid metabolic process
phospholipid catabolic process
Cellular Location
  1. Cytoplasm
  2. Peripheral membrane protein
  3. Cytoplasmic side
  4. cytosol
  5. Cytoplasmic vesicle membrane
Gene Properties
Chromosome Location 15
Locus 15q15.1
SNPs PLA2G4D
Gene Sequence
>2457 bp
ATGGAGAGCCTGTCACCTGGGGGACCAACTGGCCACCCTTACCAGGGGGAGGCCTCTACC
TGCTGGCAGCTCACAGTGAGGGTCCTGGAGGCGCGGAACCTGCGCTGGGCTGACCTGTTG
AGTGAGGCCGACCCTTACGTGATCCTACAGCTGTCGACCGCACCTGGAATGAAGTTTAAG
ACCAAGACGCTCACCGACACCAGTCATCCTGTGTGGAATGAGGCCTTCCGTTTCCTTATC
CAAAGTCAGGTCAAGAATGTTCTGGAGCTTAGCATCTATGATGAGGACTCAGTCACGGAG
GATGACATCTGCTTCAAGGTTCTCTATGACATCTCAGAAGTCCTCCCTGGCAAGCTGCTC
CGGAAAACCTTCTCCCAGAGTCCCCAGGGAGAGGAGGAGCTGGATGTGGAGTTCCTGATG
GAAGAAACGTCAGATCGCCCAGAAAACCTCATCACCAACAAAGTCATTGTGGCCCGAGAG
CTGTCATGCCTGGATGTGCATCTGGACAGCACAGGGAGCACCGCTGTGGTTGCAGATCAG
GACAAGCTGGAGCTGGAGCTGGTGCTGAAGGGGTCCTATGAGGACACACAGACATCCTTC
CTGGGCACAGCCTCTGCCTTCCGCTTCCACTACATGGCAGCCCTAGAGACAGAGCTGAGC
GGGCGCCTGAGGAGCTCCAGAAGCAATGGCTGGAATGGGGACAACTCAGCTGGGTACCTC
ACTGTGCCCCTGAGGCCCTTGACCATTGGGAAGGAGGTGACTATGGATGTTCCTGCTCCA
AATGCCCCAGGAGTGAGGCTGCAGCTCAAGGCAGAGGGCTGCCCTGAGGAGCTGGCCGTG
CACCTGGGCTTCAATCTCTGTGCAGAGGAGCAGGCCTTCCTGAGCAGGAGGAAGCAGGTG
GTGGCCAAGGCCCTGAAGCAGGCCCTGCAGCTGGACAGAGACCTGCAGGAGGATGAGGTA
CCCGTTGTGGGCATCATGGCCACAGGAGGAGGTGCCCGGGCCATGACCTCACTCTACGGC
CACCTATTGGCCTTGCAGAAGCTGGGCCTCCTAGACTGTGTGACCTACTTCAGTGGCATC
TCTGGCTCTACGTGGACAATGGCCCACCTGTACGGGGACCCTGAGTGGTCGCAGAGGGAC
CTGGAGGGACCTATCAGATACGCCCGGGAGCACCTGGCCAAGAGCAAGCTGGAGGTCTTT
TCCCCAGAGCGCCTGGCGAGCTACCGCCGGGAGCTGGAGCTGCGGGCTGAGCAGGGCCAC
CCCACGACCTTTGTGGACCTGTGGGCGCTAGTGCTGGAGTCCATGCTGCACGGCCAGGTG
ATGGATCAGAAGCTGTCAGGACAGAGAGCCGCCCTGGAACGGGGTCAGAACCCTCTGCCC
CTCTACTTGAGCCTCAATGTCAAAGAGAACAATCTGGAGACACTGGACTTCAAGGAGTGG
GTTGAGTTCTCCCCCTATGAGGTCGGTTTCCTGAAGTACGGGGCCTTCGTCCCTCCTGAG
CTCTTCGGCTCCGAGTTCTTCATGGGACGGCTGATGAGGAGGATCCCGGAGCCCCGGATC
TGCTTTCTGGAAGCCATCTGGAGCAACATTTTCTCCCTGAACCTGCTGGATGCCTGGTAT
GACCTCACCAGTTCTGGGGAGTCCTGGAAACAGCACATCAAGGACAAGACCAGGAGCTTA
GAGAAGGAGCCCCTGACCACCTCGGGGACCTCCTCGCGGCTGGAGGCCTCGTGGCTGCAG
CCAGGCACGGCGCTGGCCCAGGCATTTAAAGGCTTCCTGACAGGCAGGCCCCTCCACCAG
CGCAGCCCCAACTTCCTCCAGGGCCTCCAGCTGCACCAGGACTACTGTAGCCACAAAGAC
TTCTCCACCTGGGCAGACTACCAGCTTGACTCCATGCCCAGCCAGCTGACCCCCAAGGAG
CCCCGGCTCTGCCTGGTGGACGCCGCCTACTTCATCAACACCAGCTCTCCCTCCATGTTC
CGGCCAGGCCGCAGGCTGGACCTCATCCTCTCCTTCGACTACTCCCTATCTGCGCCCTTC
GAGGCACTGCAGCAGACGGAGCTGTACTGCCGGGCCCGGGGGCTGCCCTTCCCCCGGGTG
GAACCCAGCCCTCAGGACCAGCACCAGCCAAGGGAATGCCACCTCTTCTCAGACCCCGCC
TGCCCCGAGGCCCCGATCCTGCTGCACTTCCCGCTGGTCAATGCCTCCTTCAAGGACCAC
TCAGCCCCCGGTGTCCAGCGCAGCCCCGCAGAGCTCCAGGGTGGCCAAGTGGATCTCACC
GGGGCCACCTGCCCCTACACCCTGTCCAACATGACCTACAAGGAGGAAGACTTCGAGCGC
CTGCTGCGGCTCAGTGACTACAACGTGCAGACCAGCCAGGGTGCCATCCTGCAGGCCCTG
AGGACCGCGCTGAAGCACCGGACTCTAGAGGCGAGGCCTCCAAGGGCACAGACCTGA
Protein Properties
Number of Residues 818
Molecular Weight 91951.405
Theoretical pI 5.503
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Cytosolic phospholipase A2 delta
MESLSPGGPPGHPYQGEASTCWQLTVRVLEARNLRWADLLSEADPYVILQLSTAPGMKFK
TKTLTDTSHPVWNEAFRFLIQSQVKNVLELSIYDEDSVTEDDICFKVLYDISEVLPGKLL
RKTFSQSPQGEEELDVEFLMEETSDRPENLITNKVIVARELSCLDVHLDSTGSTAVVADQ
DKLELELVLKGSYEDTQTSFLGTASAFRFHYMAALETELSGRLRSSRSNGWNGDNSAGYL
TVPLRPLTIGKEVTMDVPAPNAPGVRLQLKAEGCPEELAVHLGFNLCAEEQAFLSRRKQV
VAKALKQALQLDRDLQEDEVPVVGIMATGGGARAMTSLYGHLLALQKLGLLDCVTYFSGI
SGSTWTMAHLYGDPEWSQRDLEGPIRYAREHLAKSKLEVFSPERLASYRRELELRAEQGH
PTTFVDLWALVLESMLHGQVMDQKLSGQRAALERGQNPLPLYLSLNVKENNLETLDFKEW
VEFSPYEVGFLKYGAFVPPELFGSEFFMGRLMRRIPEPRICFLEAIWSNIFSLNLLDAWY
DLTSSGESWKQHIKDKTRSLEKEPLTTSGTSSRLEASWLQPGTALAQAFKGFLTGRPLHQ
RSPNFLQGLQLHQDYCSHKDFSTWADYQLDSMPSQLTPKEPRLCLVDAAYFINTSSPSMF
RPGRRLDLILSFDYSLSAPFEALQQTELYCRARGLPFPRVEPSPQDQHQPRECHLFSDPA
CPEAPILLHFPLVNASFKDHSAPGVQRSPAELQGGQVDLTGATCPYTLSNMTYKEEDFER
LLRLSDYNVQTSQGAILQALRTALKHRTLEARPPRAQT
GenBank ID Protein 29467442
UniProtKB/Swiss-Prot ID Q86XP0
UniProtKB/Swiss-Prot Entry Name PA24D_HUMAN
PDB IDs Not Available
GenBank Gene ID AB090876
GeneCard ID PLA2G4D
GenAtlas ID PLA2G4D
HGNC ID HGNC:30038
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. [PubMed:16572171 ]
  3. Chiba H, Michibata H, Wakimoto K, Seishima M, Kawasaki S, Okubo K, Mitsui H, Torii H, Imai Y: Cloning of a gene for a novel epithelium-specific cytosolic phospholipase A2, cPLA2delta, induced in psoriatic skin. J Biol Chem. 2004 Mar 26;279(13):12890-7. Epub 2004 Jan 6. [PubMed:14709560 ]
  4. Tao R, Yu Y, Zhang X, Shi J, Guo Y, Wang C, Han B, Xu Q, Shang H, Zhang X, Xie L, Liu S, Ju G, Shen Y, Wei J: A family based study of the genetic association between the PLA2G4D gene and schizophrenia. Prostaglandins Leukot Essent Fatty Acids. 2005 Dec;73(6):419-22. Epub 2005 Oct 6. [PubMed:16213696 ]