Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07865
Secondary Accession Numbers
  • 13576
Name Cytosolic phospholipase A2 zeta
Synonyms
  1. Phospholipase A2 group IVF
  2. cPLA2-zeta
Gene Name PLA2G4F
Protein Type Unknown
Biological Properties
General Function Involved in metabolic process
Specific Function Calcium-dependent phospholipase A2 that selectively hydrolyzes glycerophospholipids in the sn-2 position. Has higher enzyme activity for phosphatidylethanolamine than phosphatidylcholine (By similarity).
Pathways
  • alpha-Linolenic acid metabolism
  • Arachidonic acid metabolism
  • Ether lipid metabolism
  • Fc epsilon RI signaling pathway
  • Fc gamma R-mediated phagocytosis
  • Glutamatergic synapse
  • Glycerophospholipid metabolism
  • GnRH signaling pathway
  • Linoleic acid metabolism
  • Long-term depression
  • MAPK signaling pathway
  • Serotonergic synapse
  • Vascular smooth muscle contraction
  • VEGF signaling pathway
Reactions
Phosphatidylcholine + Water → 1-acylglycerophosphocholine + a carboxylate details
Phosphatidylcholine + Water → 1-Acyl-sn-glycero-3-phosphocholine + Fatty acid details
Phosphatidylcholine + Water → 1-Acyl-sn-glycero-3-phosphocholine + Arachidonic acid details
Phosphatidylethanolamine + Water → 1-Acyl-sn-glycero-3-phosphoethanolamine + Fatty acid details
Phosphatidylcholine + Water → 1-Acyl-sn-glycero-3-phosphocholine + Linoleic acid details
O-1-Alk-1-enyl-2-acyl-sn-glycero-3-phosphoethanolamine + Water → 1-(1-Alkenyl)-sn-glycero-3-phosphoethanolamine + Carboxylate details
1-Radyl-2-acyl-sn-glycero-3-phosphocholine + Water → 1-Organyl-2-lyso-sn-glycero-3-phosphocholine + Carboxylate details
Phosphatidylcholine + Water → 1-Acyl-sn-glycero-3-phosphocholine + alpha-Linolenic acid details
GO Classification
Biological Process
phosphatidylcholine acyl-chain remodeling
phosphatidylethanolamine acyl-chain remodeling
phosphatidylinositol acyl-chain remodeling
phosphatidylserine acyl-chain remodeling
cellular response to antibiotic
phospholipid catabolic process
arachidonic acid secretion
cellular response to organic cyclic compound
glycerophospholipid biosynthetic process
phosphatidylglycerol acyl-chain remodeling
prostaglandin biosynthetic process
Cellular Component
cytosol
vesicle
ruffle membrane
lysosomal membrane
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
lipase activity
phospholipase activity
Molecular Function
metal ion binding
lysophospholipase activity
calcium-dependent phospholipase A2 activity
Process
metabolic process
organophosphate metabolic process
phospholipid metabolic process
phospholipid catabolic process
Cellular Location
  1. Cytoplasm
  2. Peripheral membrane protein
  3. Cytoplasmic side
  4. Lysosome membrane
  5. cytosol
Gene Properties
Chromosome Location 15
Locus 15q15.1
SNPs PLA2G4F
Gene Sequence
>2550 bp
ATGCTTTGGGCACTCTGGCCAAGGTGGCTGGCAGACAAGATGCTGCCCCTCCTGGGGGCA
GTGCTGCTTCAGAAGAGAGAGAAGAGGGGCCCTCTGTGGAGGCACTGGCGGCGGGAAACC
TACCCATACTATGACCTCCAGGTGAAGGTGCTGAGGGCCACAAACATCCGGGGCACAGAC
CTGCTGTCCAAAGCCGACTGCTATGTGCAACTGTGGCTGCCCACGGCGTCCCCAAGCCCT
GCCCAGACTAGGATAGTGGCCAACTGCAGTGACCCCGAGTGGAATGAGACCTTCCACTAC
CAGATCCATGGTGCTGTGAAGAACGTCCTGGAGCTCACCCTCTATGACAAGGACATCCTG
GGCAGCGACCAGCTCTCTCTGCTCCTGTTTGACCTGAGAAGCCTCAAGTGTGGCCAACCT
CACAAACACACCTTCCCACTCAACCACCAGGATTCACAAGAGCTGCAGGTGGAATTTGTT
CTGGAGAAGAGCCAGGTGCCTGCATCTGAAGTCATCACCAACGGGGTTCTGGTGGCTCAC
CCCTGTCTGAGAATCCAGGGCACGCTCCGGGGAGATGGGACAGCCCCACGGGAAGAGTAC
GGCTCTAGGCAGCTCCAGCTGGCAGTGCCTGGAGCCTACGAGAAGCCACAGCTCTTGCCC
CTGCAGCCTCCCACAGAGCCAGGCCTCCCACCCACCTTTACCTTCCACGTGAACCCAGTG
CTGAGCTCCAGGCTACACGTGGAGCTGATGGAGCTGCTGGCAGCTGTGCAGAGTGGCCCC
AGCGCAGAGTTGGAGGCTCAGACCAGCAAGCTGGGCGAGGGGGGCATCCTGCTCTCCTCT
CTGCCCCTAGGCCAGGAGGAACAGTGTTCTGTGGCCCTGGGGGAGGGCCAGGAGGTGGCT
CTGAGCATGAAGGTGGAAATGAGCTCCGGGGACCTAGACCTACGCCTTGGCTTTGACCTC
TCTGACGGGGAGCAGGAGTTTCTGGACAGGAGGAAGCAGGTCGTGTCCAAGGCCCTGCAG
CAAGTGCTGGGATTGAGTGAGGCTCTGGACAGTGGCCAGGTGCCTGTAGTGGCTGTGTTG
GGTTCCGGGGGTGGAACCCGAGCCATGTCTTCTCTGTACGGCAGCCTGGCAGGGTTGCAG
GAGCTCGGCCTTCTAGACACTGTGACCTACCTGAGTGGGGTCTCTGGGTCTACCTGGTGC
ATCTCCACACTCTACAGGGACCCAGCCTGGTCCCAGGTGGCCTTGCAGGGCCCCATTGAG
CGTGCCCAGGTTCACGTCTGCAGCAGTAAGATGGGAGCTTTGTCCACGGAGCGGCTACAG
TACTACACTCAGGAACTGGGGGTCCGGGAGCGCAGTGGCCACAGCGTGTCCCTCATCGAC
CTCTGGGGCCTCCTTGTTGAGTATCTCCTGTACCAGGAGGAGAACCCTGCCAAGCTGTCT
GACCAACAGGAGGCGGTCCGCCAGGGTCAGAACCCTTACCCCATTTACACCAGTGTCAAC
GTCCGCACCAACTTGAGTGGGGAAGATTTTGCAGAGTGGTGCGAGTTCACGCCCTATGAG
GTTGGCTTCCCCAAGTACGGGGCTTATGTTCCCACCGAGCTCTTCGGCTCAGAACTCTTC
ATGGGACGATTGCTGCAGCTCCAGCCTGAACCCCGGATCTGTTACCTGCAAGGTATGTGG
GGCAGCGCCTTTGCCACCAGCCTGGATGAGATCTTCCTAAAGACCGCCGGCTCGGGCCTC
AGCTTCCTGGAGTGGTACAGAGGCAGTGTGAATATCACAGACGACTGCCAGAAGCCTCAG
CTGCACAACCCCTCGAGGCTGCGAACGAGGCTCCTCACCCCACAGGGGCCCTTCTCCCAG
GCTGTGCTGGACATATTCACCTCCCGCTTCACTTCCGCCCAGAGCTTTAACTTCACCCGG
GGTCTCTGCTTGCACAAGGACTATGTGGCTGGCAGGGAGTTCGTGGCCTGGAAAGACACA
CACCCGGACGCCTTCCCCAACCAGCTCACCCCCATGCGGGACTGCCTGTACCTGGTGGAC
GGAGGCTTTGCCATCAACTCTCCGTTCCCACTGGCTCTGCTGCCTCAGAGAGCAGTGGAC
CTCATTCTGTCCTTTGACTATTCCTTGGAAGCCCCTTTTGAGGTCTTGAAGATGACAGAG
AAGTACTGCCTGGACCGAGGAATCCCCTTCCCTAGCATCGAGGTGGGCCCTGAGGACATG
GAGGAGGCCCGTGAGTGCTATCTGTTTGCCAAGGCTGAGGACCCCCGCTCCCCCATTGTG
CTGCACTTCCCCCTGGTTAACCGTACCTTCCGCACACACCTGGCCCCAGGTGTGGAGCGA
CAAACAGCTGAGGAGAAGGCCTTTGGGGACTTTGTCATCAACAGGCCAGACACCCCCTAT
GGCATGATGAACTTCACCTATGAGCCCCAGGACTTTTATCGGCTGGTGGCCCTCAGTCGA
TACAACGTCCTGAACAACGTGGAGACCTTGAAGTGCGCCCTCCAGCTGGCTCTGGACCGG
CACCAGGCTCGGGAGAGGGCAGGGGCCTGA
Protein Properties
Number of Residues 849
Molecular Weight 95081.5
Theoretical pI 5.439
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Cytosolic phospholipase A2 zeta
MLWALWPRWLADKMLPLLGAVLLQKREKRGPLWRHWRRETYPYYDLQVKVLRATNIRGTD
LLSKADCYVQLWLPTASPSPAQTRIVANCSDPEWNETFHYQIHGAVKNVLELTLYDKDIL
GSDQLSLLLFDLRSLKCGQPHKHTFPLNHQDSQELQVEFVLEKSQVPASEVITNGVLVAH
PCLRIQGTLRGDGTAPREEYGSRQLQLAVPGAYEKPQLLPLQPPTEPGLPPTFTFHVNPV
LSSRLHVELMELLAAVQSGPSAELEAQTSKLGEGGILLSSLPLGQEEQCSVALGEGQEVA
LSMKVEMSSGDLDLRLGFDLSDGEQEFLDRRKQVVSKALQQVLGLSEALDSGQVPVVAVL
GSGGGTRAMSSLYGSLAGLQELGLLDTVTYLSGVSGSTWCISTLYRDPAWSQVALQGPIE
RAQVHVCSSKMGALSTERLQYYTQELGVRERSGHSVSLIDLWGLLVEYLLYQEENPAKLS
DQQEAVRQGQNPYPIYTSVNVRTNLSGEDFAEWCEFTPYEVGFPKYGAYVPTELFGSELF
MGRLLQLQPEPRICYLQGMWGSAFATSLDEIFLKTAGSGLSFLEWYRGSVNITDDCQKPQ
LHNPSRLRTRLLTPQGPFSQAVLDIFTSRFTSAQSFNFTRGLCLHKDYVAGREFVAWKDT
HPDAFPNQLTPMRDCLYLVDGGFAINSPFPLALLPQRAVDLILSFDYSLEAPFEVLKMTE
KYCLDRGIPFPSIEVGPEDVEEARECYLFAKAEDPRSPIVLHFPLVNRTFRTHLAPGVER
QTAEEKAFGDFVINRPDTPYGMMNFTYEPQDFYRLVALSRYNVLNNVETLKCALQLALDR
HQARERAGA
GenBank ID Protein 281371376
UniProtKB/Swiss-Prot ID Q68DD2
UniProtKB/Swiss-Prot Entry Name PA24F_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_213600.3
GeneCard ID PLA2G4F
GenAtlas ID PLA2G4F
HGNC ID HGNC:27396
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  3. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. [PubMed:16572171 ]