You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07866
Secondary Accession Numbers
  • 13577
Name Protocadherin-11 X-linked
Synonyms
  1. PCDH-X
  2. Protocadherin on the X chromosome
  3. Protocadherin-11
  4. Protocadherin-S
Gene Name PCDH11X
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Potential calcium-dependent cell-adhesion protein
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
plasma membrane
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Process
cell adhesion
cellular process
cell-cell adhesion
homophilic cell adhesion
Cellular Location
  1. Cell membrane
  2. Single-pass type I membrane protein (Potential)
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs PCDH11X
Gene Sequence
>4044 bp
ATGGACTTGTTGTCCGGGACGTACATTTTCGCGGTCCTGCTAGCATGCGTGGTGTTCCAC
TCTGGCGCCCAGGAGAAAAACTACACCATCCGAGAAGAAATGCCAGAAAACGTCCTGATA
GGCGACTTGTTGAAAGACCTTAACTTGTCGCTGATTCCAAACAAGTCCTTGACAACTGCT
ATGCAGTTCAAGCTAGTGTACAAGACCGGAGATGTGCCACTGATTCGAATTGAAGAGGAT
ACTGGTGAGATCTTCACTACTGGCGCTCGCATTGATCGTGAGAAATTATGTGCTGGTATC
CCAAGGGATGAGCATTGCTTTTATGAAGTGGAGGTTGCCATTTTGCCGGATGAAATATTT
AGACTGGTTAAGATACGTTTTCTGATAGAAGATATAAATGATAATGCACCATTGTTCCCA
GCAACAGTTATCAACATATCAATTCCAGAGAACTCGGCTATAAACTCTAAATATACTCTC
CCAGCGGCTGTTGATCCTGACGTAGGAATAAACGGAGTTCAAAACTACGAACTAATTAAG
AGTCAAAACATTTTTGGCCTCGATGTCATTGAAACACCAGAAGGAGACAAGATGCCACAA
CTGATTGTTCAAAAGGAGTTAGATAGGGAAGAGAAGGATACCTACGTGATGAAAGTAAAG
GTTGAAGATGGTGGCTTTCCTCAAAGATCCAGTACTGCTATTTTGCAAGTGAGTGTTACT
GATACAAATGACAACCACCCAGTCTTTAAGGAGACAGAGATTGAAGTCAGTATACCAGAA
AATGCTCCTGTAGGCACTTCAGTGACACAGCTCCATGCCACAGATGCTGACATAGGTGAA
AATGCCAAGATCCACTTCTCTTTCAGCAATCTAGTCTCCAACATTGCCAGGAGATTATTT
CACCTCAATGCCACCACTGGACTTATCACAATCAAAGAACCACTGGATAGGGAAGAAACA
CCAAACCACAAGTTACTGGTTTTGGCAAGTGATGGTGGATTGATGCCAGCAAGAGCAATG
GTGCTGGTAAATGTTACAGATGTCAATGATAATGTCCCATCCATTGACATAAGATACATC
GTCAATCCTGTCAATGACACAGTTGTTCTTTCAGAAAATATTCCACTCAACACCAAAATT
GCTCTCATAACTGTGACGGATAAGGATGCGGACCATAATGGCAGGGTGACATGCTTCACA
GATCATGAAATCCCTTTCAGATTAAGGCCAGTATTCAGTAATCAGTTCCTCCTGGAGACT
GCAGCATATCTTGACTATGAGTCCACAAAAGAATATGCCATTAAATTACTGGCTGCAGAT
GCTGGCAAACCTCCTTTGAATCAGTCAGCAATGCTCTTCATCAAAGTGAAAGATGAAAAT
GACAATGCTCCAGTTTTCACCCAGTCTTTCGTAACTGTTTCTATTCCTGAGAATAACTCT
CCTGGCATCCAGTTGACGAAAGTAAGTGCAATGGATGCAGACAGTGGGCCTAATGCTAAG
ATCAATTACCTGCTAGGCCCTGATGCTCCACCTGAATTCAGCCTGGATTGTCGTACAGGC
ATGCTGACTGTAGTGAAGAAACTAGATAGAGAAAAAGAGGATAAATATTTATTCACAATT
CTGGCAAAAGATAACGGGGTACCACCCTTAACCAGCAATGTCACAGTCTTTGTAAGCATT
ATTGATCAGAATGACAATAGCCCAGTTTTCACTCACAATGAATACAACTTCTATGTCCCA
GAAAACCTTCCAAGGCATGGTACAGTAGGACTAATCACTGTAACTGATCCTGATTATGGA
GACAATTCTGCAGTTACGCTCTCCATTTTAGATGAGAATGATGACTTCACCATTGATTCA
CAAACTGGTGTCATCCGACCAAATATTTCATTTGATAGAGAAAAACAAGAATCTTACACT
TTCTATGTAAAGGCTGAGGATGGTGGTAGAGTATCACGTTCTTCAAGTGCCAAAGTAACC
ATAAATGTGGTTGATGTCAATGACAACAAACCAGTTTTCATTGTCCCTCCTTCCAACTGT
TCTTATGAATTGGTTCTACCGTCCACTAATCCAGGCACAGTGGTCTTTCAGGTAATTGCT
GTTGACAATGACACTGGCATGAATGCAGAGGTTCGTTACAGCATTGTAGGAGGAAACACA
AGAGATCTGTTTGCAATCGACCAAGAAACAGGCAACATAACATTGATGGAGAAATGTGAT
GTTACAGACCTTGGTTTACACAGAGTGTTGGTCAAAGCTAATGACTTAGGACAGCCTGAT
TCTCTCTTCAGTGTTGTAATTGTCAATCTGTTCGTGAATGAGTCGGTGACCAATGCTACA
CTGATTAATGAACTGGTGCGCAAAAGCACTGAAGCACCAGTGACCCCAAATACTGAGATA
GCTGATGTATCCTCACCAACTAGTGACTATGTCAAGATCCTGGTTGCAGCTGTTGCTGGC
ACCATAACTGTCGTTGTAGTTATTTTCATCACTGCTGTAGTAAGATGTCGCCAGGCACCA
CACCTTAAGGCTGCTCAGAAAAACAAGCAGAATTCTGAATGGGCTACCCCAAACCCAGAA
AACAGGCAGATGATAATGATGAAGAAAAAGAAAAAGAAGAAGAAGCATTCCCCTAAGAAC
TTGCTGCTTAATTTTGTCACTATTGAAGAAACTAAGGCAGATGATGTTGACAGTGATGGA
AACAGAGTCACACTAGACCTTCCTATTGATCTAGAAGAGCAAACAATGGGAAAGTACAAT
TGGGTAACTACACCTACTACTTTCAAGCCCGACAGCCCTGATTTGGCCCGACACTACAAA
TCTGCCTCTCCACAGCCTGCCTTCCAAATTCAGCCTGAAACTCCCCTGAATTCGAAGCAC
CACATCATCCAAGAACTGCCTCTCGATAACACCTTTGTGGCCTGTGACTCTATCTCCAAG
TGTTCCTCAAGCAGTTCAGATCCCTACAGCGTTTCTGACTGTGGCTATCCAGTGACGACC
TTCGAGGTACCTGTGTCCGTACACACCAGACCGCCAATGAAGGAGGTTGTGCGATCTTGC
ACCCCCATGAAAGAGTCTACAACTATGGAGATCTGGATTCATCCCCAACCACAGCGGAAA
TCTGAAGGGAAAGTGGCAGGAAAGTCCCAGCGGCGTGTCACATTTCACCTGCCAGAAGGC
TCTCAGGAAAGCAGCAGTGATGGTGGACTGGGAGACCATGATGCAGGCAGCCTTACCAGC
ACATCTCATGGCCTGCCCCTTGGCTATCCTCAGGAGGAGTACTTTGATCGTGCTACACCC
AGCAATCGCACTGAAGGGGATGGCAACTCCGATCCTGAATCTACTTTCATACCTGGACTA
AAGAAAGCTGCAGAAATAACTGTTCAACCAACTGTGGAAGAGGCCTCTGACAACTGCACT
CAAGAATGTCTCATCTATGGCCATTCTGATGCCTGCTGGATGCCGGCATCTCTGGATCAT
TCCAGCTCTTCGCAAGCACAGGCCTCTGCTCTATGCCACAGCCCACCACTGTCACAGGCC
TCTACTCAGCACCACAGCCCACGAGTGACACAGACCATTGCTCTCTGCCACAGCCCTCCA
GTGACACAGACCATCGCATTGTGCCACAGCCCACCACCGATACAGGTGTCTGCTCTCCAC
CACAGTCCTCCTCTAGTGCAGGCTACTGCACTTCACCACAGCCCACCATCAGCACAGGCC
TCAGCCCTCTGCTACAGCCCTCCTTTAGCACAGGCTGCTGCAATCAGCCACAGCTCTCCT
CTGCCACAGGTTATTGCCCTCCATCGTAGTCAGGCCCAATCATCAGTCAGTTTGCAGCAA
GGTTGGGTGCAAGGTGCTGATGGGCTATGCTCTGTTGATCAGGGAGTGCAAGGTAGTGCA
ACATCTCAGTTTTACACCATGTCTGAAAGACTTCATCCCAGTGATGATTCAATTAAAGTC
ATTCCTTTGACAACCTTCACTCCACGCCAACAGGCCAGACCGTCCAGAGGTGATTCCCCC
ATTATGGAAGAACATCCCTTGTAA
Protein Properties
Number of Residues 1347
Molecular Weight 147557.1
Theoretical pI 4.84
Pfam Domain Function
Signals
  • 1-23
Transmembrane Regions
  • 813-833
Protein Sequence
>Protocadherin-11 X-linked
MDLLSGTYIFAVLLACVVFHSGAQEKNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTA
MQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIF
RLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIK
SQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVT
DTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLF
HLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYI
VNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLET
AAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNS
PGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTI
LAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYG
DNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVT
INVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNT
RDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNAT
LINELVRKSTEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVVRCRQAP
HLKAAQKNKQNSEWATPNPENRQMIMMKKKKKKKKHSPKNLLLNFVTIEETKADDVDSDG
NRVTLDLPIDLEEQTMGKYNWVTTPTTFKPDSPDLARHYKSASPQPAFQIQPETPLNSKH
HIIQELPLDNTFVACDSISKCSSSSSDPYSVSDCGYPVTTFEVPVSVHTRPPMKEVVRSC
TPMKESTTMEIWIHPQPQRKSEGKVAGKSQRRVTFHLPEGSQESSSDGGLGDHDAGSLTS
TSHGLPLGYPQEEYFDRATPSNRTEGDGNSDPESTFIPGLKKAAEITVQPTVEEASDNCT
QECLIYGHSDACWMPASLDHSSSSQAQASALCHSPPLSQASTQHHSPRVTQTIALCHSPP
VTQTIALCHSPPPIQVSALHHSPPLVQATALHHSPPSAQASALCYSPPLAQAAAISHSSP
LPQVIALHRSQAQSSVSLQQGWVQGADGLCSVDQGVQGSATSQFYTMSERLHPSDDSIKV
IPLTTFTPRQQARPSRGDSPIMEEHPL
GenBank ID Protein 14589920
UniProtKB/Swiss-Prot ID Q9BZA7
UniProtKB/Swiss-Prot Entry Name PC11X_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_032968.3
GeneCard ID PCDH11X
GenAtlas ID PCDH11X
HGNC ID HGNC:8656
References
General References
  1. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651 ]
  2. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  3. Nagase T, Kikuno R, Ishikawa KI, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Feb 28;7(1):65-73. [PubMed:10718198 ]
  4. Skaletsky H, Kuroda-Kawaguchi T, Minx PJ, Cordum HS, Hillier L, Brown LG, Repping S, Pyntikova T, Ali J, Bieri T, Chinwalla A, Delehaunty A, Delehaunty K, Du H, Fewell G, Fulton L, Fulton R, Graves T, Hou SF, Latrielle P, Leonard S, Mardis E, Maupin R, McPherson J, Miner T, Nash W, Nguyen C, Ozersky P, Pepin K, Rock S, Rohlfing T, Scott K, Schultz B, Strong C, Tin-Wollam A, Yang SP, Waterston RH, Wilson RK, Rozen S, Page DC: The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes. Nature. 2003 Jun 19;423(6942):825-37. [PubMed:12815422 ]
  5. Yoshida K, Sugano S: Identification of a novel protocadherin gene (PCDH11) on the human XY homology region in Xq21.3. Genomics. 1999 Dec 15;62(3):540-3. [PubMed:10644456 ]
  6. Blanco P, Sargent CA, Boucher CA, Mitchell M, Affara NA: Conservation of PCDHX in mammals; expression of human X/Y genes predominantly in brain. Mamm Genome. 2000 Oct;11(10):906-14. [PubMed:11003707 ]
  7. Blanco-Arias P, Sargent CA, Affara NA: Protocadherin X ( PCDHX) and Y ( PCDHY) genes; multiple mRNA isoforms encoding variant signal peptides and cytoplasmic domains. Mamm Genome. 2004 Jan;15(1):41-52. [PubMed:14727141 ]