Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07944
Secondary Accession Numbers
  • 13655
Name Prokineticin receptor 2
Synonyms
  1. G-protein coupled receptor 73-like 1
  2. GPR73b
  3. GPRg2
  4. PK-R2
Gene Name PROKR2
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Receptor for prokineticin 2. Exclusively coupled to the G(q) subclass of heteromeric G proteins. Activation leads to mobilization of calcium, stimulation of phosphoinositide turnover and activation of p44/p42 mitogen-activated protein kinase
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
neuropeptide receptor activity
receptor activity
neuropeptide y receptor activity
molecular transducer activity
signal transducer activity
peptide receptor activity
peptide receptor activity, g-protein coupled
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:2
Locus 20p12.3
SNPs PROKR2
Gene Sequence
>1155 bp
ATGGCAGCCCAGAATGGAAACACCAGTTTCACACCCAACTTTAATCCACCCCAAGACCAT
GCCTCCTCCCTCTCCTTTAACTTCAGTTATGGTGATTATGACCTCCCTATGGATGAGGAT
GAGGACATGACCAAGACCCGGACCTTCTTCGCAGCCAAGATCGTCATTGGCATTGCACTG
GCAGGCATCATGCTGGTCTGCGGCATCGGTAACTTTGTCTTTATCGCTGCCCTCACCCGC
TATAAGAAGTTGCGCAACCTCACCAATCTGCTCATTGCCAACCTGGCCATCTCCGACTTC
CTGGTGGCCATCATCTGCTGCCCCTTCGAGATGGACTACTACGTGGTACGGCAGCTCTCC
TGGGAGCATGGCCACGTGCTCTGTGCCTCCGTCAACTACCTGCGCACCGTCTCCCTCTAC
GTCTCCACCAATGCCTTGCTGGCCATTGCCATTGACAGATATCTCGCCATCGTTCACCCC
TTGAAACCACGGATGAATTATCAAACGGCCTCCTTCCTGATCGCCTTGGTCTGGATGGTG
TCCATTCTCATTGCCATCCCATCGGCTTACTTTGCAACAGAAACGGTCCTCTTTATTGTC
AAGAGCCAGGAGAAGATCTTCTGTGGCCAGATCTGGCCTGTGGATCAGCAGCTCTACTAC
AAGTCCTACTTCCTCTTCATCTTTGGTGTCGAGTTCGTGGGCCCTGTGGTCACCATGACC
CTGTGCTATGCCAGGATCTCCCGGGAGCTCTGGTTCAAGGCAGTCCCTGGGTTCCAGACG
GAGCAGATTCGCAAGCGGCTGCGCTGCCGCAGGAAGACGGTCCTGGTGCTCATGTGCATT
CTCACGGCCTATGTGCTGTGCTGGGCACCCTTCTACGGTTTCACCATCGTTCGTGACTTC
TTCCCCACTGTGTTCGTGAAGGAAAAGCACTACCTCACTGCCTTCTACGTGGTCGAGTGC
ATCGCCATGAGCAACAGCATGATCAACACCGTGTGCTTCGTGACGGTCAAGAACAACACC
ATGAAGTACTTCAAGAAGATGATGCTGCTGCACTGGCGTCCCTCCCAGCGGGGGAGCAAG
TCCAGTGCTGACCTTGACCTCAGAACCAACGGGGTGCCCACCACAGAAGAGGTGGACTGT
ATCAGGCTGAAGTGA
Protein Properties
Number of Residues 384
Molecular Weight 43995.4
Theoretical pI 8.94
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 55-75
  • 90-110
  • 137-157
  • 172-192
  • 224-244
  • 274-294
  • 314-334
Protein Sequence
>Prokineticin receptor 2
MAAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTFFAAKIVIGIAL
AGIMLVCGIGNFVFIAALTRYKKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVRQLS
WEHGHVLCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLKPRMNYQTASFLIALVWMV
SILIAIPSAYFATETVLFIVKSQEKIFCGQIWPVDQQLYYKSYFLFIFGVEFVGPVVTMT
LCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRDF
FPTVFVKEKHYLTAFYVVECIAMSNSMINTVCFVTVKNNTMKYFKKMMLLHWRPSQRGSK
SSADLDLRTNGVPTTEEVDCIRLK
GenBank ID Protein 25006243
UniProtKB/Swiss-Prot ID Q8NFJ6
UniProtKB/Swiss-Prot Entry Name PKR2_HUMAN
PDB IDs Not Available
GenBank Gene ID AB084081
GeneCard ID PROKR2
GenAtlas ID PROKR2
HGNC ID HGNC:15836
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052 ]
  3. Soga T, Matsumoto Si, Oda T, Saito T, Hiyama H, Takasaki J, Kamohara M, Ohishi T, Matsushime H, Furuichi K: Molecular cloning and characterization of prokineticin receptors. Biochim Biophys Acta. 2002 Dec 12;1579(2-3):173-9. [PubMed:12427552 ]
  4. Lin DC, Bullock CM, Ehlert FJ, Chen JL, Tian H, Zhou QY: Identification and molecular characterization of two closely related G protein-coupled receptors activated by prokineticins/endocrine gland vascular endothelial growth factor. J Biol Chem. 2002 May 31;277(22):19276-80. Epub 2002 Mar 8. [PubMed:11886876 ]
  5. Dode C, Teixeira L, Levilliers J, Fouveaut C, Bouchard P, Kottler ML, Lespinasse J, Lienhardt-Roussie A, Mathieu M, Moerman A, Morgan G, Murat A, Toublanc JE, Wolczynski S, Delpech M, Petit C, Young J, Hardelin JP: Kallmann syndrome: mutations in the genes encoding prokineticin-2 and prokineticin receptor-2. PLoS Genet. 2006 Oct 20;2(10):e175. Epub 2006 Sep 1. [PubMed:17054399 ]