You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07945
Secondary Accession Numbers
  • 13656
Name Calcium-independent phospholipase A2-gamma
Synonyms
  1. Intracellular membrane-associated calcium-independent phospholipase A2 gamma
  2. PNPLA-gamma
  3. Patatin-like phospholipase domain-containing protein 8
  4. iPLA2-2
  5. iPLA2-gamma
Gene Name PNPLA8
Protein Type Unknown
Biological Properties
General Function Involved in metabolic process
Specific Function Calcium-independent phospholipase A2, which catalyzes the hydrolysis of the sn-2 position of glycerophospholipids, PtdSer and to a lower extent PtdCho. Cleaves membrane phospholipids.
Pathways Not Available
Reactions
2-lysophosphatidylcholine + Water → Glycerophosphocholine + a carboxylate details
GO Classification
Biological Process
phosphatidylcholine acyl-chain remodeling
phosphatidylethanolamine acyl-chain remodeling
phosphatidylcholine catabolic process
arachidonic acid secretion
phosphatidylethanolamine catabolic process
linoleic acid metabolic process
arachidonic acid metabolic process
glycerophospholipid biosynthetic process
prostaglandin biosynthetic process
cell death
Cellular Component
endoplasmic reticulum membrane
perinuclear region of cytoplasm
peroxisomal membrane
integral to membrane
Golgi membrane
Function
binding
Molecular Function
lysophospholipase activity
ATP binding
calcium-independent phospholipase A2 activity
Process
metabolic process
primary metabolic process
lipid metabolic process
Cellular Location
  1. Cytoplasm
  2. perinuclear region
  3. Golgi apparatus membrane
  4. Endoplasmic reticulum membrane
  5. Single-pass membrane protein
  6. Single-pass membrane protein
Gene Properties
Chromosome Location 7
Locus 7q31
SNPs PNPLA8
Gene Sequence
>2349 bp
ATGTCTATTAATCTGACTGTAGATATATATATTTACCTCCTTAGTAATGCAAGAAGTGTT
TGTGGGAAGCAGAGAAGCAAGCAACTGTATTTCTTGTTCTCACCTAAGCATTACTGGAGG
ATAAGCCACATCAGTCTACAAAGAGGTTTTCATACAAACATAATAAGATGTAAATGGACC
AAAAGTGAAGCACATTCTTGCAGTAAGCACTGTTACTCTCCAAGCAACCATGGTTTACAT
ATTGGGATTTTGAAACTTAGCACTTCTGCTCCCAAGGGACTTACAAAAGTGAACATTTGT
ATGTCCCGTATTAAAAGTACTTTGAACTCTGTTTCAAAGGCTGTTTTTGGCAATCAAAAT
GAAATGATTTCACGTTTAGCTCAATTTAAGCCAAGTTCCCAAATTTTAAGAAAAGTATCG
GATAGTGGCTGGTTAAAACAGAAAAACATCAAACAAGCCATCAAATCTCTGAAAAAATAT
AGTGACAAATCAGCAGAAAAGAGTCCTTTTCCAGAAGAGAAAAGTCACATTATAGACAAA
GAAGAAGATATAGGTAAACGCAGTCTTTTTCATTACACAAGTTCTATAACCACAAAATTT
GGAGACTCATTCTACTTTTTATCAAATCATATTAATTCATATTTCAAACGTAAGGAAAAA
ATGTCTCAACAAAAGGAAAATGAACATTTCCGGGACAAATCAGAACTTGAAGATAAAAAG
GTAGAAGAGGGGAAATTAAGATCTCCAGATCCTGGCATCCTGGCTTATAAGCCAGGCTCA
GAATCTGTACATACGGTGGACAAGCCTACAAGTCCTTCTGCGATACCTGATGTTCTTCAA
GTTTCAACTAAACAAAGTATTGCTAACTTTCTTTCTCGTCCCACGGAAGGTGTACAAGCT
TTAGTAGGTGGTTATATTGGTGGACTTGTCCCCAAATTAAAGTATGATTCAAAGAGTCAG
TCAGAAGAACAGGAAGAGCCTGCTAAAACTGATCAGGCTGTCAGCAAAGACAGAAATGCA
GAGGAGAAAAAGCGTTTATCTCTTCAGCGAGAAAAGATTATCGCAAGGGTGAGTATTGAT
AACAGGACCCGGGCATTAGTTCAGGCATTAAGAAGAACAACTGACCCAAAGCTCTGCATT
ACTAGGGTTGAAGAACTGACTTTTCATCTTCTAGAATTTCCTGAAGGAAAAGGAGTGGCT
GTCAAGGAAAGAATTATTCCATATTTATTACGACTGAGACAAATTAAGGATGAAACTCTT
CAGGCTGCAGTTAGAGAAATTTTGGCCCTAATTGGCTATGTGGATCCAGTGAAAGGGAGA
GGAATCCGAATTCTCTCAATTGATGGTGGAGGAACAAGGGGCGTGGTTGCTCTCCAGACC
CTACGAAAATTAGTTGAACTTACTCAGAAGCCAGTTCATCAGCTCTTTGATTACATTTGT
GGTGTAAGCACAGGTGCCATATTAGCTTTCATGTTGGGGTTGTTTCATATGCCCTTGGAT
GAATGTGAGGAACTTTATCGAAAATTAGGATCAGATGTATTTTCACAAAATGTCATTGTT
GGAACAGTAAAAATGAGTTGGAGCCATGCATTTTATGACAGTCAAACATGGGAAAACATT
CTTAAGGATAGGATGGGATCTGCACTGATGATTGAAACAGCAAGAAACCCCACATGTCCT
AAGGTAGCTGCTGTAAGTACCATAGTAAATAGAGGGATAACACCCAAAGCTTTTGTGTTC
AGAAACTATGGTCATTTTCCTGGAATCAACTCTCATTATTTGGGAGGCTGTCAGTATAAA
ATGTGGCAGGCCATTAGAGCCTCATCTGCTGCTCCAGGCTACTTTGCAGAATATGCATTG
GGAAATGATCTTCATCAAGATGGAGGTTTGCTTCTGAATAACCCTTCGGCATTAGCTATG
CATGAGTGTAAATGTCTTTGGCCAGATGTGCCGTTAGAGTGCATAGTATCCCTGGGCACT
GGACGTTATGAGAGTGATGTGAGAAACACGGTAACATACACAAGCTTGAAAACTAAACTT
TCTAATGTTATCAACAGTGCTACAGATACAGAAGAAGTCCATATAATGCTTGATGGCCTG
TTACCTCCTGACACCTATTTTAGATTCAATCCTGTAATGTGTGAAAACATACCTCTAGAT
GAAAGTCGAAATGAAAAGCTGGATCAGCTGCAGTTGGAAGGGTTGAAATACATAGAAAGA
AATGAACAAAAAATGAAAAAAGTTGCAAAAATATTAAGTCAAGAAAAAACAACTCTGCAG
AAAATTAATGATTGGATAAAATTAAAAACTGATATGTATGAAGGACTTCCATTCTTTTCA
AAATTGTGA
Protein Properties
Number of Residues 782
Molecular Weight 88476.085
Theoretical pI 9.23
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Calcium-independent phospholipase A2-gamma
MSINLTVDIYIYLLSNARSVCGKQRSKQLYFLFSPKHYWRISHISLQRGFHTNIIRCKWT
KSEAHSCSKHCYSPSNHGLHIGILKLSTSAPKGLTKVNICMSRIKSTLNSVSKAVFGNQN
EMISRLAQFKPSSQILRKVSDSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDK
EEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENEHFRDKSELEDKK
VEEGKLRSPDPGILAYKPGSESVHTVDKPTSPSAIPDVLQVSTKQSIANFLSRPTEGVQA
LVGGYIGGLVPKLKYDSKSQSEEQEEPAKTDQAVSKDRNAEEKKRLSLQREKIIARVSID
NRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKGVAVKERIIPYLLRLRQIKDETL
QAAVREILALIGYVDPVKGRGIRILSIDGGGTRGVVALQTLRKLVELTQKPVHQLFDYIC
GVSTGAILAFMLGLFHMPLDECEELYRKLGSDVFSQNVIVGTVKMSWSHAFYDSQTWENI
LKDRMGSALMIETARNPTCPKVAAVSTIVNRGITPKAFVFRNYGHFPGINSHYLGGCQYK
MWQAIRASSAAPGYFAEYALGNDLHQDGGLLLNNPSALAMHECKCLWPDVPLECIVSLGT
GRYESDVRNTVTYTSLKTKLSNVINSATDTEEVHIMLDGLLPPDTYFRFNPVMCENIPLD
ESRNEKLDQLQLEGLKYIERNEQKMKKVAKILSQEKTTLQKINDWIKLKTDMYEGLPFFS
KL
GenBank ID Protein 7670058
UniProtKB/Swiss-Prot ID Q9NP80
UniProtKB/Swiss-Prot Entry Name PLPL8_HUMAN
PDB IDs Not Available
GenBank Gene ID AB041261
GeneCard ID PNPLA8
GenAtlas ID PNPLA8
HGNC ID HGNC:28900
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. [PubMed:12690205 ]
  5. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948 ]
  6. Tanaka H, Takeya R, Sumimoto H: A novel intracellular membrane-bound calcium-independent phospholipase A(2). Biochem Biophys Res Commun. 2000 Jun 7;272(2):320-6. [PubMed:10833412 ]
  7. Mancuso DJ, Jenkins CM, Gross RW: The genomic organization, complete mRNA sequence, cloning, and expression of a novel human intracellular membrane-associated calcium-independent phospholipase A(2). J Biol Chem. 2000 Apr 7;275(14):9937-45. [PubMed:10744668 ]
  8. Kinsey GR, Cummings BS, Beckett CS, Saavedra G, Zhang W, McHowat J, Schnellmann RG: Identification and distribution of endoplasmic reticulum iPLA2. Biochem Biophys Res Commun. 2005 Feb 4;327(1):287-93. [PubMed:15629460 ]
  9. Murakami M, Masuda S, Ueda-Semmyo K, Yoda E, Kuwata H, Takanezawa Y, Aoki J, Arai H, Sumimoto H, Ishikawa Y, Ishii T, Nakatani Y, Kudo I: Group VIB Ca2+-independent phospholipase A2gamma promotes cellular membrane hydrolysis and prostaglandin production in a manner distinct from other intracellular phospholipases A2. J Biol Chem. 2005 Apr 8;280(14):14028-41. Epub 2005 Feb 4. [PubMed:15695510 ]