You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07949
Secondary Accession Numbers
  • 13660
Name Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
Synonyms
  1. CAM-PRP catalytic subunit
  2. Calmodulin-dependent calcineurin A subunit beta isoform
Gene Name PPP3CB
Protein Type Unknown
Biological Properties
General Function Involved in hydrolase activity
Specific Function Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin.
Pathways
  • Alzheimer's disease
  • Amphetamine addiction
  • Amyotrophic lateral sclerosis (ALS)
  • Apoptosis
  • Axon guidance
  • B cell receptor signaling pathway
  • Calcium signaling pathway
  • Dopaminergic synapse
  • Glutamatergic synapse
  • HTLV-I infection
  • Long-term potentiation
  • MAPK signaling pathway
  • Natural killer cell mediated cytotoxicity
  • Oocyte meiosis
  • Osteoclast differentiation
  • T cell receptor signaling pathway
  • Tuberculosis
  • VEGF signaling pathway
  • Wnt signaling pathway
Reactions
A phosphoprotein + Water → a protein + Phosphate details
GO Classification
Biological Process
signal transduction
muscle cell homeostasis
cellular response to drug
positive regulation of insulin secretion involved in cellular response to glucose stimulus
response to amphetamine
heart development
social behavior
memory
positive regulation of transcription, DNA-dependent
T cell differentiation
regulation of synaptic plasticity
protein phosphorylation
learning
T cell homeostasis
response to cytokine stimulus
axon extension
calcium ion-dependent exocytosis
negative regulation of T cell mediated cytotoxicity
T cell proliferation
protein dephosphorylation
Cellular Component
cytosol
plasma membrane
calcineurin complex
Function
catalytic activity
hydrolase activity
Molecular Function
calcium ion binding
drug binding
calmodulin-dependent protein phosphatase activity
protein phosphatase 2B binding
calmodulin binding
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location 10
Locus 10q22.2
SNPs PPP3CB
Gene Sequence
>1575 bp
ATGGCCGCCCCGGAGCCGGCCCGGGCTGCACCGCCCCCACCCCCGCCCCCGCCGCCCCCT
CCCGGGGCTGACCGCGTCGTCAAAGCTGTCCCTTTCCCCCCAACACATCGCTTGACATCT
GAAGAAGTATTTGATTTGGATGGGATACCCAGGGTTGATGTTCTGAAGAACCACTTGGTG
AAAGAAGGTCGAGTAGATGAAGAAATTGCGCTTAGAATTATCAATGAGGGTGCTGCCATC
CTTCGGAGAGAGAAAACCATGATAGAAGTAGAAGCTCCAATCACAGTGTGTGGTGACATC
CATGGCCAATTTTTTGATCTGATGAAACTTTTTGAAGTAGGAGGATCACCTGCTAATACA
CGATACCTTTTTCTTGGCGATTATGTGGACAGAGGTTATTTTAGTATAGAGTGTGTCTTA
TATTTATGGGTTCTGAAGATTCTATACCCAAGCACATTATTTCTTCTGAGAGGCAACCAT
GAATGCAGACACCTTACTGAATATTTTACCTTTAAGCAGGAATGTAAAATTAAGTATTCG
GAAAGAGTCTATGAAGCTTGTATGGAAGCTTTTGATAGTTTGCCTCTTGCTGCACTTTTA
AACCAACAGTTTCTTTGTGTTCATGGTGGACTTTCACCAGAAATACACACACTGGATGAT
ATTAGGAGATTAGATAGATTCAAAGAGCCACCTGCATTTGGACCAATGTGTGACTTGTTA
TGGTCCGATCCTTCTGAAGATTTTGGAAATGAAAAATCACAGGAACATTTTAGTCACAAT
ACAGTTCGAGGATGTTCTTATTTTTATAACTATCCAGCAGTGTGTGAATTTTTGCAAAAC
AATAATTTGTTATCGATTATTAGAGCTCATGAAGCTCAAGATGCAGGCTATAGAATGTAC
AGAAAAAGTCAAACTACAGGGTTCCCTTCATTAATAACAATTTTTTCGGCACCTAATTAC
TTAGATGTCTACAATAATAAAGCTGCTGTATTAAAGTATGAAAATAATGTGATGAATATT
CGACAGTTTAACTGTTCTCCACATCCTTACTGGTTGCCTAATTTTATGGATGTCTTCACG
TGGTCTTTACCGTTTGTTGGAGAAAAAGTGACAGAAATGTTGGTAAATGTTCTGAGTATT
TGCTCTGATGATGAACTAATGACTGAAGGTGAAGACCAGTTTGATGGTTCAGCTGCAGCC
CGGAAAGAAATCATAAGAAACAAAATTCGAGCAATTGGCAAGATGGCAAGAGTCTTCTCT
GTTCTCAGGGAGGAGAGTGAAAGTGTGCTGACACTCAAGGGCCTGACTCCCACAGGGATG
TTGCCTAGTGGAGTGTTAGCTGGAGGACGGCAGACCCTGCAAAGTGCCACAGTTGAGGCT
ATTGAGGCTGAAAAAGCAATACGAGGATTCTCTCCACCACATAGAATCTGCAGTTTTGAA
GAGGCAAAGGGTTTGGATAGGATCAATGAGAGAATGCCACCTCGGAAAGATGCTGTACAG
CAAGATGGTTTCAATTCTCTGAACACCGCACATGCCACTGAGAACCACGGGACGGGCAAC
CATACTGCCCAGTGA
Protein Properties
Number of Residues 524
Molecular Weight 59122.87
Theoretical pI 5.903
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
MAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLV
KEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANT
RYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYS
ERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLL
WSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMY
RKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFT
WSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDGSAAARKEIIRNKIRAIGKMARVFS
VLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFE
EAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P16298
UniProtKB/Swiss-Prot Entry Name PP2BB_HUMAN
PDB IDs Not Available
GenBank Gene ID M29551
GeneCard ID PPP3CB
GenAtlas ID PPP3CB
HGNC ID HGNC:9315
References
General References
  1. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  2. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  3. Guerini D, Klee CB: Cloning of human calcineurin A: evidence for two isozymes and identification of a polyproline structural domain. Proc Natl Acad Sci U S A. 1989 Dec;86(23):9183-7. [PubMed:2556704 ]
  4. McPartlin AE, Barker HM, Cohen PT: Identification of a third alternatively spliced cDNA encoding the catalytic subunit of protein phosphatase 2B beta. Biochim Biophys Acta. 1991 Feb 16;1088(2):308-10. [PubMed:1848109 ]