You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07961
Secondary Accession Numbers
  • 13672
Name Pyroglutamylated RFamide peptide receptor
Synonyms
  1. AQ27
  2. G-protein coupled receptor 103
  3. Orexigenic neuropeptide QRFP receptor
  4. SP9155
Gene Name QRFPR
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Receptor for the orexigenic neuropeptide QRFP. The activity of this receptor is mediated by G proteins that modulate adenylate cyclase activity and intracellular calcium levels
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
neuropeptide receptor activity
receptor activity
neuropeptide y receptor activity
molecular transducer activity
signal transducer activity
peptide receptor activity
peptide receptor activity, g-protein coupled
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:4
Locus 4q27
SNPs QRFPR
Gene Sequence
>1296 bp
ATGCAGGCGCTTAACATTACCCCGGAGCAGTTCTCTCGGCTGCTGCGGGACCACAACCTG
ACGCGGGAGCAGTTCATCGCAGTTCATCGCCTGCGACCGCTCGTCTACACCCCAGAGCTG
CCGGGACGCGCCAAGCTGGCCCTCGTGCTCACCGGCGTGCTCATCTTCGCCCTGGCGCTC
TTTGGCAATGCTCTGGTGTTCTACGTGGTGACCCGCAGCAAGGCCATGCGCACCGTCACC
AACATCTTTATCTGCTCCTTGGCGCTCAGTGACCTGCTCATCACCTTCTTCTGCATTCCC
GTCACCATGCTCCAGAACATTTCCGACAACTGGCTGGGGGGTGCTTTCATTTGCAAGATG
GTGCCATTTGTCCAGTCTACCGCTGTTGTGACAGAAATCCTCACTATGACCTGCATTGCT
GTGGAAAGGCACCAGGGACTTGTGCATCCTTTTAAAATGAAGTGGCAATACACCAACCGA
AGGGCTTTCACAATGCTAGGTGTGGTCTGGCTGGTGGCAGTCATCGTAGGATCACCCATG
TGGCACGTGCAACAACTTGAGATCAAATATGACTTCCTATATGAAAAGGAACACATCTGC
TGCTTAGAAGAGTGGACCAGCCCTGTGCACCAGAAGATCTACACCACCTTCATCCTTGTC
ATCCTCTTCCTCCTGCCTCTTATGGTGATGCTTATTCTGTACAGTAAAATTGGTTATGAA
CTTTGGATAAAGAAAAGAGTTGGGGATGGTTCAGTGCTTCGAACTATTCATGGAAAAGAA
ATGTCCAAAATAGCCAGGAAGAAGAAACGAGCTGTCATTATGATGGTGACAGTGGTGGCT
CTCTTTGCTGTGTGCTGGGCACCATTCCATGTTGTCCATATGATGATTGAATACAGTAAT
TTTGAAAAGGAATATGATGATGTCACAATCAAGATGATTTTTGCTATCGTGCAAATTATT
GGATTTTCCAACTCCATCTGTAATCCCATTGTCTATGCATTTATGAATGAAAACTTCAAA
AAAAATGTTTTGTCTGCAGTTTGTTATTGCATAGTAAATAAAACCTTCTCTCCAGCACAA
AGGCATGGAAATTCAGGAATTACAATGATGCGGAAGAAAGCAAAGTTTTCCCTCAGAGAG
AATCCAGTGGAGGAAACCAAAGGAGAAGCATTCAGTGATGGCAACATTGAAGTCAAATTG
TGTGAACAGACAGAGGAGAAGAAAAAGCTCAAACGACATCTTGCTCTCTTTAGGTCTGAA
CTGGCTGAGAATTCTCCTTTAGACAGTGGGCATTAA
Protein Properties
Number of Residues 431
Molecular Weight 49487.4
Theoretical pI 9.51
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 47-67
  • 82-102
  • 121-141
  • 163-183
  • 213-233
  • 272-292
  • 312-332
Protein Sequence
>Pyroglutamylated RFamide peptide receptor
MQALNITPEQFSRLLRDHNLTREQFIALYRLRPLVYTPELPGRAKLALVLTGVLIFALAL
FGNALVFYVVTRSKAMRTVTNIFICSLALSDLLITFFCIPVTMLQNISDNWLGGAFICKM
VPFVQSTAVVTEILTMTCIAVERHQGLVHPFKMKWQYTNRRAFTMLGVVWLVAVIVGSPM
WHVQQLEIKYDFLYEKEHICCLEEWTSPVHQKIYTTFILVILFLLPLMVMLILYSKIGYE
LWIKKRVGDGSVLRTIHGKEMSKIARKKKRAVIMMVTVVALFAVCWAPFHVVHMMIEYSN
FEKEYDDVTIKMIFAIVQIIGFSNSICNPIVYAFMNENFKKNVLSAVCYCIVNKTFSPAQ
RHGNSGITMMRKKAKFSLRENPVEETKGEAFSDGNIEVKLCEQTEEKKKLKRHLALFRSE
LAENSPLDSGH
GenBank ID Protein 37651191
UniProtKB/Swiss-Prot ID Q96P65
UniProtKB/Swiss-Prot Entry Name QRFPR_HUMAN
PDB IDs Not Available
GenBank Gene ID AB109629
GeneCard ID QRFPR
GenAtlas ID QRFPR
HGNC ID HGNC:15565
References
General References
  1. Lee DK, Nguyen T, Lynch KR, Cheng R, Vanti WB, Arkhitko O, Lewis T, Evans JF, George SR, O'Dowd BF: Discovery and mapping of ten novel G protein-coupled receptor genes. Gene. 2001 Sep 5;275(1):83-91. [PubMed:11574155 ]
  2. Jiang Y, Luo L, Gustafson EL, Yadav D, Laverty M, Murgolo N, Vassileva G, Zeng M, Laz TM, Behan J, Qiu P, Wang L, Wang S, Bayne M, Greene J, Monsma F Jr, Zhang FL: Identification and characterization of a novel RF-amide peptide ligand for orphan G-protein-coupled receptor SP9155. J Biol Chem. 2003 Jul 25;278(30):27652-7. Epub 2003 Apr 24. [PubMed:12714592 ]
  3. Fukusumi S, Yoshida H, Fujii R, Maruyama M, Komatsu H, Habata Y, Shintani Y, Hinuma S, Fujino M: A new peptidic ligand and its receptor regulating adrenal function in rats. J Biol Chem. 2003 Nov 21;278(47):46387-95. Epub 2003 Sep 5. [PubMed:12960173 ]