You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07962
Secondary Accession Numbers
  • 13673
Name Ras GTPase-activating protein 4
Synonyms
  1. Calcium-promoted Ras inactivator
  2. Ras p21 protein activator 4
  3. RasGAP-activating-like protein 2
Gene Name RASA4
Protein Type Unknown
Biological Properties
General Function Involved in GTPase activator activity
Specific Function Ca(2+)-dependent Ras GTPase-activating protein, that switches off the Ras-MAPK pathway following a stimulus that elevates intracellular calcium. Functions as an adaptor for Cdc42 and Rac1 during FcR-mediated phagocytosis
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
enzyme regulator activity
enzyme activator activity
gtpase activator activity
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signaling pathway
signaling
signaling pathway
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location
  1. Cell membrane
  2. Cytoplasm
  3. Peripheral membrane protein
  4. cytosol
Gene Properties
Chromosome Location Chromosome:7
Locus 7q22
SNPs RASA4
Gene Sequence
>2412 bp
ATGGCCAAGCGCAGCTCGCTGTACATCCGCATCGTGGAGGGGAAGAACCTTCCCGCCAAG
GACATCACTGGCAGCAGCGACCCCTACTGCATCGTGAAGGTGGACAATGAGCCCATCATC
AGGACAGCCACAGTGTGGAAGACCCTGTGCCCCTTCTGGGGTGAGGAGTACCAAGTGCAC
CTGCCGCCCACCTTCCACGCTGTGGCTTTCTATGTCATGGATGAGGATGCCCTCAGCCGG
GACGACGTTATCGGAAAGGTCTGCCTTACAAGGGACACCATAGCCTCTCACCCTAAGGGT
TTCAGCGGGTGGGCCCACCTGACGGAGGTCGACCCCGATGAGGAGGTGCAGGGCGAGATC
CACCTGCGGCTGGAAGTGTGGCCAGGGGCCCGGGCCTGCCGGCTACGCTGCTCTGTGCTG
GAGGCCAGGGATCTGGCCCCAAAGGACCGCAATGGCACATCTGACCCCTTCGTCCGAGTG
CGCTACAAGGGCCGGACACGGGAGACCTCGATCGTGAAGAAGTCATGCTACCCACGCTGG
AATGAGACGTTTGAATTTGAGCTGCAGGAGGGGGCCATGGAGGCGCTGTGCGTGGAGGCC
TGGGACTGGGACCTTGTCAGCCGAAACGACTTCCTGGGCAAAGTGGTGATTGATGTCCAG
AGACTGCGGGTGGTGCAGCAGGAGGAGGGCTGGTTCCGGCTGCAGCCCGACCAGTCCAAG
AGCCGGCGGCATGACGAGGGCAACCTGGGCTCCTTGCAGCTGGAGGTGCGGCTGCGGGAC
GAGACGGTGCTGCCCTCCAGCTACTACCAGCCACTGGTGCACCTGCTGTGCCACGAGGTC
AAGCTGGGCATGCAGGGCCCAGGGCAGCTGATCCCACTCATCGAGGAGACAACCAGCACC
GAGTGTCGCCAGGACGTGGCCACGAACCTGCTCAAGCTCTTCCTGGGGCAGGGGCTGGCC
AAGGACTTCCTGGACCTGCTCTTCCAGCTGGAGCTGAGTCGCACCAGTGAGACCAACACC
CTGTTCCGGAGCAACTCTCTGGCCTCAAAGTCCATGGAGTCTTTTCTGAAGGTGGCCGGG
ATGCAGTACCTGCACGGCGTCCTGGGCCCCATCATCAACAAGGTGTTTGAGGAGAAGAAG
TACGTGGAGCTGGACCCCAGCAAAGTGGAAGTTAAGGATGTAGGGTGCTCCGGGCTGCAC
CGCCCGCAGACCGAGGCCGAGGTGCTGGAGCAGAGCGCGCAGACGCTGCGCGCCCACCTG
GGGGCCCTGCTGAGCGCGCTCAGCCGCTCGGTTCGCGCGTGCCCCGCCGTGGTGCGCGCC
ACCTTCCGCCAGCTCTTCCGGCGCGTGCGCGAGCGCTTCCCCGGCGCCCAGCACGAGAAT
GTACCGTTCATCGCCGTCACCAGCTTCCTGTGCCTGCGCTTCTTCTCTCCCGCCATCATG
TCGCCCAAGCTCTTCCACCTGCGGGAGCGCCACGCGGACGCCCGCACCAGCCGCACCCTG
CTCCTGTTGGCCAAGGCAGTCCAGAACGTGGGCAACATGGACACGCCGGCTTCCAGGGCC
AAGGAGGCTTGGATGGAGCCGCTGCAGCCCACCGTGCGCCAGGGCGTGGCGCAGCTGAAG
GACTTCATCACCAAGCTCGTGGACATCGAGGAGAAGGACGAGCTGGACCTGCAGCGGACG
CTGAGTTTGCAGGCGCCACCTGTGAAGGAGGGGCCACTCTTCATCCACAGGACCAAGGGC
AAGGGCCCCCTCATGTCCTCCTCCTTCAAGAAGCTCTACTTCTCCCTCACTACCGAGGCC
CTCAGCTTCGCGAAGACGCCCAGCTCCAAGAAAAGCGCCCTCATCAAGTTAGCCAACATC
CGGGCAGCGGAAAAGGTTGAGGAAAAGAGCTTTGGCGGCTCGCACGTCATGCAGGTCATC
TACACGGACGACGCCGGCAGGCCCCAGACTGCCTACCTGCAGTGCAAGTGTGTGAATGAG
CTTAACCAGTGGCTGTCTGCGCTGCGGAAGGTGAGCATCAACAACACCGGACTGCTGGGC
TCCTACCACCCTGGCGTCTTCCGTGGGGACAAGTGGAGCTGCTGCCACCAAAAAGAGAAG
ACAGGTCAGGGCTGCGATAAGACCCGGTCACGGGTGACCCTGCAGGAGTGGAATGACCCT
CTTGACCATGACCTTGAGGCCCAGCTCATCTACCGGCACCTGCTGGGCGTGGAGGCCATG
CTGTGGGAGAGGCACCGGGAGCTGAGCGGGGGCGCAGAGGCAGGCACGGTGCCCACGAGC
CCTGGCAAAGTCCCCGAGGACTCATTGGCCCGGCTGCTCCGGGTGCTGCAGGACCTCCGC
GAGGCCCATAGCTCCAGCCCGGCCGGCTCCCCACCCTCAGAGCCCAACTGCCTCCTGGAG
CTGCAGACGTGA
Protein Properties
Number of Residues 803
Molecular Weight 90456.8
Theoretical pI 7.89
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ras GTPase-activating protein 4
MAKRSSLYIRIVEGKNLPAKDITGSSDPYCIVKVDNEPIIRTATVWKTLCPFWGEEYQVH
LPPTFHAVAFYVMDEDALSRDDVIGKVCLTRDTIASHPKGFSGWAHLTEVDPDEEVQGEI
HLRLEVWPGARACRLRCSVLEARDLAPKDRNGTSDPFVRVRYKGRTRETSIVKKSCYPRW
NETFEFELQEGAMEALCVEAWDWDLVSRNDFLGKVVIDVQRLRVVQQEEGWFRLQPDQSK
SRRHDEGNLGSLQLEVRLRDETVLPSSYYQPLVHLLCHEVKLGMQGPGQLIPLIEETTST
ECRQDVATNLLKLFLGQGLAKDFLDLLFQLELSRTSETNTLFRSNSLASKSMESFLKVAG
MQYLHGVLGPIINKVFEEKKYVELDPSKVEVKDVGCSGLHRPQTEAEVLEQSAQTLRAHL
GALLSALSRSVRACPAVVRATFRQLFRRVRERFPGAQHENVPFIAVTSFLCLRFFSPAIM
SPKLFHLRERHADARTSRTLLLLAKAVQNVGNMDTPASRAKEAWMEPLQPTVRQGVAQLK
DFITKLVDIEEKDELDLQRTLSLQAPPVKEGPLFIHRTKGKGPLMSSSFKKLYFSLTTEA
LSFAKTPSSKKSALIKLANIRAAEKVEEKSFGGSHVMQVIYTDDAGRPQTAYLQCKCVNE
LNQWLSALRKVSINNTGLLGSYHPGVFRGDKWSCCHQKEKTGQGCDKTRSRVTLQEWNDP
LDHDLEAQLIYRHLLGVEAMLWERHRELSGGAEAGTVPTSPGKVPEDSLARLLRVLQDLR
EAHSSSPAGSPPSEPNCLLELQT
GenBank ID Protein 299829177
UniProtKB/Swiss-Prot ID O43374
UniProtKB/Swiss-Prot Entry Name RASL2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_006989.5
GeneCard ID RASA4
GenAtlas ID RASA4
HGNC ID HGNC:23181
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948 ]
  3. Nagase T, Ishikawa K, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1998 Feb 28;5(1):31-9. [PubMed:9628581 ]
  4. Lockyer PJ, Kupzig S, Cullen PJ: CAPRI regulates Ca(2+)-dependent inactivation of the Ras-MAPK pathway. Curr Biol. 2001 Jun 26;11(12):981-6. [PubMed:11448776 ]