You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07972
Secondary Accession Numbers
  • 13683
Name Regulating synaptic membrane exocytosis protein 1
Synonyms
  1. RIM 1
  2. Rab-3-interacting molecule 1
  3. Rab-3-interacting protein 2
Gene Name RIMS1
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Rab effector involved in exocytosis. May act as scaffold protein that regulates neurotransmitter release at the active zone. Essential for maintaining normal probability of neurotransmitter release and for regulating release during short- term synaptic plasticity
Pathways Not Available
Reactions Not Available
GO Classification
Function
small gtpase regulator activity
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
enzyme regulator activity
rab gtpase binding
protein binding
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
establishment of localization
transport
protein transport
intracellular protein transport
Cellular Location
  1. Cell membrane
  2. Peripheral membrane protein
  3. Peripheral membrane protein
  4. Cell junction
  5. Cell junction
  6. synapse
  7. synapse
  8. presynaptic cell membrane
Gene Properties
Chromosome Location Chromosome:6
Locus 6q12-q13
SNPs RIMS1
Gene Sequence
>5079 bp
ATGTCCTCGGCCGTGGGGCCCCGCGGTCCTCGCCCACCCACGGTGCCTCCCCCCATGCAA
GAGCTGCCCGACCTGAGCCACCTGACCGAAGAGGAGAGGAACATTATCATGGCAGTGATG
GACCGGCAGAAGGAAGAGGAGGAAAAAGAAGAAGCCATGCTCAAGTGTGTTGTCAGGGAC
ATGGCGAAGCCTGCTGCCTGCAAAACACCAAGAAATGCTGAAAACCAGCCCCACCAACCT
TCACCGAGATTGCATCAACAGTTTGAAAGCTATAAGGAACAAGTGAGAAAAATAGGGGAA
GAAGCGCGGCGTTACCAGGGCGAGCACAAAGACGATGCTCCGACTTGTGGAATCTGTCAT
AAAACAAAGTTTGCTGATGGGTGCGGTCATCTCTGCTCCTATTGTCGCACTAAGTTCTGT
GCGCGCTGCGGAGGCCGCGTGTCTCTACGGTCAAACAACGAGGACAAAGTGGTTATGTGG
GTATGCAATTTATGTCGAAAGCAACAAGAAATCTTAACCAAATCTGGGGCATGGTTCTTT
GGAAGTGGCCCTCAGCAGACAAGTCAGGATGGAACCCTGAGTGATACAGCTACAGGTGCT
GGCTCTGAGGTACCAAGAGAAAAGAAAGCACGACTCCAAGAGCGATCGCGGTCTCAGACA
CCCCTAAGCACAGCAGCTGCCTCCTCCCAGGATGCTGCTCCTCCCAGCGCACCACCAGAC
AGGAGCAAAGGGGCTGAGCCCTCGCAGCAAGCCTTGGGGCCTGAACAGAAGCAGGCTTCA
TCCAGGTCTAGAAGTGAACCTCCTAGAGAGAGAAAGAAGACCCCAGGGCTTTCCGAGCAG
AATGGCAAAGGAGCCCTGAAGAGCGAGCGGAAACGCGTGCCAAAGACCTCAGCGCAGCCC
GTGGAGGGGGCCGTCGAAGAACGGGAGCGCAAAGAAAGGCGGGAAAGCCGAAGGCTTGAG
AAAGGGCGATCACAGGATTACCCAGACACGCCGGAAAAACGGGATGAGGGCAAAGCGGCG
GATGAGGAAAAGCAAAGAAAAGAGGAGGATTATCAGACCAGGTACCGCAGCGACCCGAAC
CTAGCTCGGTACCCGGTGAAACCGCCGCCTGAGGAGCAGCAGATGCGCATGCACGCCCGG
GTGTCCCGCGCCAGGCACGAGCGGCGCCACAGCGACGTGGCGCTCCCGCGCACCGAGGCG
GGCGCGGCGCTGCCGGAGGGCAAGGCCGGCAAACGCGCGCCGGCGGCAGCCAGGGCCTCG
CCGCCGGACTCGCCGCGGGCTTACTCGGCTGAGAGAACTGCGGAGACCAGGGCGCCGGGC
GCCAAGCAGCTAACGAACCACAGCCCGCCGGCGCCCAGACATGGGCCGGTTCCCGCAGAA
GCCCCGGAGCTCAAAGCCCAGGAGCCCCTCAGGAAGCAGAGCCGCCTGGACCCCAGCTCG
GCGGTCCTCATGCGGAAGGCCAAGCGCGAGAAGGTGGAGACCATGCTGCGGAACGACTCT
TTGAGCTCAGACCAGTCCGAGTCGGTGCGGCCGTCCCCGCCCAAGCCGCACCGGTCCAAG
AGAGGCGGCAAGAAGCGGCAGATGTCGGTGAGCAGCTCTGAGGAGGAGGGCGTGTCGACG
CCCGAGTACACCAGCTGCGAGGACGTGGAGCTGGAGAGCGAGAGCGTCAGCGAGAAAGGT
GATTTGGATTATTACTGGTTGGATCCTGCCACGTGGCACAGCCGGGAGACATCACCTATT
AGTTCGCATCCTGTAACGTGGCAACCATCTAAAGAGGGGGACCGATTAATTGGACGTGTT
ATTCTTAACAAGAGAACAACCATGCCCAAAGACTCAGGTGCATTGCTGGGTCTGAAAGTT
GTTGGAGGAAAAATGACTGACTTAGGACGACTTGGTGCTTTCATCACCAAAGTAAAGAAG
GGTAGCCTAGCAGATGTAGTTGGACACCTAAGAGCAGGGGATGAAGTTCTAGAATGGAAT
GGTAAACCCCTGCCGGGAGCTACAAATGAAGAAGTTTACAACATTATTTTAGAATCAAAA
TCAGAACCTCAAGTTGAAATTATTGTTTCAAGGCCTATTGGTGACATTCCCCGGATTCCT
GAGAGCTCCCACCCTCCACTGGAGTCCAGTTCAAGTTCCTTTGAATCTCAGAAGATGGAA
AGGCCTTCCATTTCTGTTATTTCTCCAACAAGTCCTGGAGCTCTAAAAGATGCCCCACAA
GTCTTACCAGGGCAACTTTCTGTGAAGTTGTGGTATGATAAAGTGGGACACCAGCTGATT
GTAAATGTTCTGCAAGCAACAGATCTACCTGCTAGAGTAGATGGACGTCCTCGAAATCCC
TATGTAAAAATGTATTTTCTTCCAGATAGAAGTGATAAAAGTAAAAGGAGGACCAAAACA
GTAAAGAAAATACTAGAACCAAAATGGAATCAAACTTTTGTCTATTCACATGTACATCGT
AGAGATTTTAGAGAACGAATGTTAGAAATAACTGTGTGGGACCAACCAAGAGTGCAAGAA
GAAGAAAGTGAATTTCTTGGAGAGATCCTCATAGAATTGGAGACAGCGCTTTTAGATGAT
GAACCGCATTGGTATAAACTTCAGACACATGATGAGTCTTCACTACCTCTGCCTCAGCCA
TCACCTTTCATGCCAAGGCGACATATTCATGGAGAAAGCTCTAGCAAAAAGCTACAAAGA
TCTCAGCGAATCAGTGATAGTGACATCTCAGATTATGAGGTTGATGATGGTATTGGCGTA
GTTCCTCCAGTAGGCTATAGGTCTAGTGCTAGAGAAAGTAAATCTACAACATTAACTGTG
CCAGAACAGCAAAGAACAACTCATCACCGCTCACGTTCAGTATCTCCTCATCGCGGCAAT
GATCAGGGAAAGCCGCGTTCACGTTTACCAAATGTGCCATTACAGAGGAGTTTAGATGAA
ATTCATCCAACAAGAAGGTCACGTTCTCCAACCAGACACCATGATGCCTCCCGAAGTCCA
GTTGATCATAGAACCAGAGATGTGGATAGTCAGTATTTATCAGAACAAGACAGTGAGCTT
CTTATGCTGCCCAGAGCAAAACGAGGACGAAGTGCAGAATGCCTACATACTACCAGACAT
CTTGTTAGGCACTATAAAACATTACCTCCCAAGATGCCTTTATTACAGAGCAGTTCTCAC
TGGAATATTTACAGCTCAATTCTGCCTGCACATACTAAGACCAAATCAGTGACTAGACAG
GACATTTCCCTTCATCATGAATGCTTTAACTCAACAGTATTGAGATTTACTGATGAAATA
CTGGTTAGTGAACTGCAGCCCTTTCTTGACAGGGCTAGGAGTGCTAGTACCAACTGCTTG
AGACCAGATACTAGTTTGCATTCACCAGAACGAGAAAGGGGTAGATGGTCCCCCTCCCTA
GATAGGAGACGACCTCCTAGTCCCAGGATTCAAATCCAGCATGCGTCTCCGGAGAATGAC
AGGCACTCCAGAAAGTCTGAAAGATCTAGCATCCAAAAACAGACTAGGAAAGGCACTGCC
TCTGATGCAGAAAGGGTTCTCCCAACATGTCTTTCTAGAAGGGGACACGCAGCCCCAAGA
GCAACTGATCAGCCAGTCATTAGGGGAAAACATCCTGCTCGCTCAAGGTCGAGTGAGCAC
TCTAGTATCAGAACACTGTGTTCTATGCACCACCTTGTCCCTGGAGGGTCGGCGCCACCT
TCTCCGCTTCTGACAAGAATGCACCGACAGAGAAGTCCAACACAATCTCCTCCAGCAGAC
ACATCGTTCAGCAGTCGCAGGGGAAGACAGCTCCCACAAGTGCCAGTGAGAAGCGGCAGT
ATAGAACAAGCAAGCTTAGTAGTGGAGGAGCGAACAAGACAGATGAAAATGAAAGTGCAT
CGATTTAAGCAGACAACAGGGTCTGGTTCTAGTCAAGAACTTGATCGCGAGCAATATTCC
AAGTATAACATACATAAAGATCAGTACAGAAGCTGTGATAACGTCTCTGCCAAATCATCA
GATAGTGATGTCAGTGATGTTTCCGCCATTTCCCGAACCAGCAGTGCCTCACGCCTCAGC
AGCACAAGCTTTATGTCAGAGCAATCTGAGCGCCCCAGGGGTAGAATCAGTTCATTTACC
CCCAAAATGCAAGGCAGACGGATGGGGACTTCAGGAAGATCCATCATGAAGAGCACCAGT
GTCAGTGGAGAGATGTACACACTGGAGCATAATGACGGCAGCCAGTCAGACACAGCTGTG
GGTACAGTTGGAGCAGGTGGAAAGAAACGGAGATCCAGCCTTAGTGCCAAAGTGGTTGCC
ATAGTGTCTCGAAGGAGTAGAAGCACATCCCAGCTTAGTCAAACAGAGTCGGGCCACAAA
AAGTTAAAAAGTACCATCCAGAGAAGCACAGAAACAGGCATGGCAGCTGAAATGAGAAAG
ATGGTAAGGCAGCCGAGCCGAGAGTCTACTGATGGCAGCATCAACAGTTACAGCTCTGAG
GGCAATTTAATATTTCCTGGAGTGCGACTGGGAGCTGACAGTCAATTCAGTGATTTTCTT
GATGGATTGGGACCAGCCCAGCTTGTTGGCCGCCAAACCCTTGCCACCCCTGCAATGGGT
GATATACAAATAGGAATGGAGGACAAAAAGGGCCAATTAGAAGTGGAAGTCATTAGAGCA
CGAAGCCTCACACAAAAGCCTGGTTCCAAATCTACACCTGCTCCATATGTCAAAGTATAT
CTTTTGGAAAATGGGGCCTGTATAGCCAAGAAGAAGACAAGAATTGCACGAAAAACCCTT
GATCCTTTGTATCAGCAGTCTCTGGTTTTTGATGAAAGTCCACAGGGTAAAGTTCTTCAG
GTGATTGTCTGGGGAGACTATGGCAGAATGGACCACAAATGCTTTATGGGTGTGGCTCAG
ATCTTGTTGGAAGAACTCGACCTGTCCAGCATGGTGATCGGATGGTACAAATTGTTCCCA
CCGTCCTCACTGGTGGATCCCACACTCACTCCCCTCACCCGGCGGGCTTCCCAGTCATCT
CTGGAAAGTTCAACTGGGCCTCCCTGTATTCGATCATAG
Protein Properties
Number of Residues 1692
Molecular Weight 189070.9
Theoretical pI 10.24
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Regulating synaptic membrane exocytosis protein 1
MSSAVGPRGPRPPTVPPPMQELPDLSHLTEEERNIIMAVMDRQKEEEEKEEAMLKCVVRD
MAKPAACKTPRNAENQPHQPSPRLHQQFESYKEQVRKIGEEARRYQGEHKDDAPTCGICH
KTKFADGCGHLCSYCRTKFCARCGGRVSLRSNNEDKVVMWVCNLCRKQQEILTKSGAWFF
GSGPQQTSQDGTLSDTATGAGSEVPREKKARLQERSRSQTPLSTAAASSQDAAPPSAPPD
RSKGAEPSQQALGPEQKQASSRSRSEPPRERKKTPGLSEQNGKGALKSERKRVPKTSAQP
VEGAVEERERKERRESRRLEKGRSQDYPDTPEKRDEGKAADEEKQRKEEDYQTRYRSDPN
LARYPVKPPPEEQQMRMHARVSRARHERRHSDVALPRTEAGAALPEGKAGKRAPAAARAS
PPDSPRAYSAERTAETRAPGAKQLTNHSPPAPRHGPVPAEAPELKAQEPLRKQSRLDPSS
AVLMRKAKREKVETMLRNDSLSSDQSESVRPSPPKPHRSKRGGKKRQMSVSSSEEEGVST
PEYTSCEDVELESESVSEKGDLDYYWLDPATWHSRETSPISSHPVTWQPSKEGDRLIGRV
ILNKRTTMPKDSGALLGLKVVGGKMTDLGRLGAFITKVKKGSLADVVGHLRAGDEVLEWN
GKPLPGATNEEVYNIILESKSEPQVEIIVSRPIGDIPRIPESSHPPLESSSSSFESQKME
RPSISVISPTSPGALKDAPQVLPGQLSVKLWYDKVGHQLIVNVLQATDLPARVDGRPRNP
YVKMYFLPDRSDKSKRRTKTVKKILEPKWNQTFVYSHVHRRDFRERMLEITVWDQPRVQE
EESEFLGEILIELETALLDDEPHWYKLQTHDESSLPLPQPSPFMPRRHIHGESSSKKLQR
SQRISDSDISDYEVDDGIGVVPPVGYRSSARESKSTTLTVPEQQRTTHHRSRSVSPHRGN
DQGKPRSRLPNVPLQRSLDEIHPTRRSRSPTRHHDASRSPVDHRTRDVDSQYLSEQDSEL
LMLPRAKRGRSAECLHTTRHLVRHYKTLPPKMPLLQSSSHWNIYSSILPAHTKTKSVTRQ
DISLHHECFNSTVLRFTDEILVSELQPFLDRARSASTNCLRPDTSLHSPERERGRWSPSL
DRRRPPSPRIQIQHASPENDRHSRKSERSSIQKQTRKGTASDAERVLPTCLSRRGHAAPR
ATDQPVIRGKHPARSRSSEHSSIRTLCSMHHLVPGGSAPPSPLLTRMHRQRSPTQSPPAD
TSFSSRRGRQLPQVPVRSGSIEQASLVVEERTRQMKMKVHRFKQTTGSGSSQELDREQYS
KYNIHKDQYRSCDNVSAKSSDSDVSDVSAISRTSSASRLSSTSFMSEQSERPRGRISSFT
PKMQGRRMGTSGRSIMKSTSVSGEMYTLEHNDGSQSDTAVGTVGAGGKKRRSSLSAKVVA
IVSRRSRSTSQLSQTESGHKKLKSTIQRSTETGMAAEMRKMVRQPSRESTDGSINSYSSE
GNLIFPGVRLGADSQFSDFLDGLGPAQLVGRQTLATPAMGDIQIGMEDKKGQLEVEVIRA
RSLTQKPGSKSTPAPYVKVYLLENGACIAKKKTRIARKTLDPLYQQSLVFDESPQGKVLQ
VIVWGDYGRMDHKCFMGVAQILLEELDLSSMVIGWYKLFPPSSLVDPTLTPLTRRASQSS
LESSTGPPCIRS
GenBank ID Protein 41054864
UniProtKB/Swiss-Prot ID Q86UR5
UniProtKB/Swiss-Prot Entry Name RIMS1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_014989.4
GeneCard ID RIMS1
GenAtlas ID RIMS1
HGNC ID HGNC:17282
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  7. Nagase T, Ishikawa K, Nakajima D, Ohira M, Seki N, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1997 Apr 28;4(2):141-50. [PubMed:9205841 ]
  8. Johnson S, Halford S, Morris AG, Patel RJ, Wilkie SE, Hardcastle AJ, Moore AT, Zhang K, Hunt DM: Genomic organisation and alternative splicing of human RIM1, a gene implicated in autosomal dominant cone-rod dystrophy (CORD7). Genomics. 2003 Mar;81(3):304-14. [PubMed:12659814 ]
  9. Coppola T, Magnin-Luthi S, Perret-Menoud V, Gattesco S, Schiavo G, Regazzi R: Direct interaction of the Rab3 effector RIM with Ca2+ channels, SNAP-25, and synaptotagmin. J Biol Chem. 2001 Aug 31;276(35):32756-62. Epub 2001 Jul 3. [PubMed:11438518 ]