You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07973
Secondary Accession Numbers
  • 13684
Name Repetin
Synonyms Not Available
Gene Name RPTN
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Involved in the cornified cell envelope formation. Multifunctional epidermal matrix protein. Reversibly binds calcium
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Cellular Location
  1. Secreted
  2. extracellular space
  3. extracellular matrix
Gene Properties
Chromosome Location Chromosome:1
Locus 1q21.3
SNPs RPTN
Gene Sequence
>2355 bp
ATGGCTCAACTCCTGAATAGCATACTCAGTGTGATTGACGTATTCCACAAATATGCCAAA
GGGAATGGGGACTGTGCCTTACTATGCAAGGAAGAGTTGAAACAACTGCTCTTGGCTGAG
TTTGGAGACATCCTCCAGAGACCAAATGACCCAGAGACTGTGGAAACCATCTTGAACCTC
TTAGATCAAGACCGAGATGGACATATTGATTTTCATGAGTACCTCTTGTTGGTGTTCCAG
TTGGTCCAAGCCTGCTATCATAAGCTAGACAATAAGTCACATGGAGGCAGGACCTCACAG
CAAGAAAGGGGGCAGGAAGGAGCACAAGACTGTAAGTTCCCAGGAAACACAGGCAGACAA
CACAGACAGAGGCACGAGGAAGAAAGGCAGAACTCCCACCACAGTCAGCCTGAGAGACAA
GACGGAGATTCCCACCATGGTCAGCCTGAGAGACAAGACAGAGATTCCCACCATGGTCAG
TCTGAGAAACAAGACAGAGATTCCCACCACAGTCAGCCTGAGAGACAAGACAGAGATTCT
CACCACAATCAGTCTGAGAGACAAGACAAGGATTTCAGCTTTGATCAGTCAGAGAGACAA
AGTCAAGACTCCAGCTCTGGTAAAAAAGTGAGTCACAAATCTACCAGTGGCCAGGCTAAA
TGGCAGGGACATATCTTTGCCTTAAATCGGTGTGAAAAACCAATTCAGGATTCTCATTAT
GGTCAGTCTGAAAGACATACACAACAATCTGAAACACTTGGACAAGCCTCTCACTTTAAC
CAGACAAATCAACAGAAATCAGGCTCTTATTGTGGACAGTCTGAGAGGCTAGGTCAGGAA
TTAGGCTGTGGTCAGACAGACAGACAAGGCCAGAGTTCCCACTACGGTCAGACGGACAGA
CAAGACCAGAGTTATCATTATGGTCAGACAGACAGACAAGGCCAGAGTTCCCACTACAGT
CAGACGGACAGACAAGGCCAGAGTTCCCACTACAGTCAGCCAGACAGACAAGGTCAGAGT
TCCCACTATGGTCAAATGGACAGAAAAGGCCAGTGTTATCATTATGATCAGACAAACAGA
CAAGGCCAGGGTTCCCACTACAGTCAACCAAACAGACAAGGTCAGAGTTCCCACTATGGT
CAGCCAGACACACAAGATCAGAGTTCTCACTATGGTCAGACAGACAGACAAGACCAAAGT
TCTCACTATGGTCAGACAGAGAGACAAGGCCAGAGTTCCCACTACAGTCAGATGGACCGA
CAAGGCCAGGGTTCTCACTACGGTCAGACAGACAGACAAGGCCAGAGTTCCCACTATGGT
CAGCCAGACAGACAAGGCCAGAATTCCCACTATGGTCAGACAGACAGACAAGGCCAGAGT
TCCCACTATGGTCAGACAGACAGACAAGGCCAGAGTTCCCACTACAGTCAGCCAGACAAA
CAAGGCCAGAGTTCCCACTATGGTAAGATAGACAGACAAGACCAGAGTTATCATTATGGT
CAGCCAGACGGACAAGGCCAAAGTTCCCACTATGGTCAGACAGACAGACAAGGCCAGAGT
TTCCACTATGGTCAGCCAGACAGACAAGGCCAGAGTTCCCACTACAGTCAGATGGACAGA
CAAGGCCAGAGTTCCCACTATGGTCAGACAGACAGACAAGGCCAGAGTTCCCACTACGGT
CAGACAGACAGACAAGGCCAGAGCTATCATTATGGTCAGACAGACAGACAAGGCCAGAGT
TCCCACTATATTCAATCACAGACTGGGGAAATACAAGGGCAAAATAAGTACTTCCAAGGG
ACTGAAGGAACAAGAAAAGCCTCTTATGTTGAACAATCAGGAAGATCAGGGAGGCTAAGT
CAACAGACTCCAGGACAGGAAGGGTACCAAAACCAGGGACAGGGATTCCAGTCTAGGGAC
TCACAGCAGAACGGCCACCAGGTATGGGAGCCTGAAGAGGATAGCCAACATCACCAACAC
AAACTCTTAGCACAAATCCAACAAGAAAGACCACTTTGTCACAAAGGGAGAGACTGGCAA
TCATGCAGTAGTGAGCAGGGCCACAGACAGGCCCAGACCAGGCAGAGTCATGGTGAGGGG
CTGAGCCACTGGGCAGAGGAAGAGCAGGGCCATCAAACTTGGGATAGACACAGCCATGAG
AGTCAGGAAGGTCCATGTGGGACACAGGACAGGCGAACCCATAAAGATGAGCAGAACCAT
CAGAGACGAGACAGACAAACCCATGAACATGAGCAGAGCCATCAGAGACGAGACAGGCAA
ACCCATGAAGACAAGCAGAACCGTCAGAGACGAGACAGGCAAACCCATGAAGACGAGCAG
AACCATCAGAGATGA
Protein Properties
Number of Residues 784
Molecular Weight 90731.2
Theoretical pI 6.92
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Repetin
MAQLLNSILSVIDVFHKYAKGNGDCALLCKEELKQLLLAEFGDILQRPNDPETVETILNL
LDQDRDGHIDFHEYLLLVFQLVQACYHKLDNKSHGGRTSQQERGQEGAQDCKFPGNTGRQ
HRQRHEEERQNSHHSQPERQDGDSHHGQPERQDRDSHHGQSEKQDRDSHHSQPERQDRDS
HHNQSERQDKDFSFDQSERQSQDSSSGKKVSHKSTSGQAKWQGHIFALNRCEKPIQDSHY
GQSERHTQQSETLGQASHFNQTNQQKSGSYCGQSERLGQELGCGQTDRQGQSSHYGQTDR
QDQSYHYGQTDRQGQSSHYSQTDRQGQSSHYSQPDRQGQSSHYGQMDRKGQCYHYDQTNR
QGQGSHYSQPNRQGQSSHYGQPDTQDQSSHYGQTDRQDQSSHYGQTERQGQSSHYSQMDR
QGQGSHYGQTDRQGQSSHYGQPDRQGQNSHYGQTDRQGQSSHYGQTDRQGQSSHYSQPDK
QGQSSHYGKIDRQDQSYHYGQPDGQGQSSHYGQTDRQGQSFHYGQPDRQGQSSHYSQMDR
QGQSSHYGQTDRQGQSSHYGQTDRQGQSYHYGQTDRQGQSSHYIQSQTGEIQGQNKYFQG
TEGTRKASYVEQSGRSGRLSQQTPGQEGYQNQGQGFQSRDSQQNGHQVWEPEEDSQHHQH
KLLAQIQQERPLCHKGRDWQSCSSEQGHRQAQTRQSHGEGLSHWAEEEQGHQTWDRHSHE
SQEGPCGTQDRRTHKDEQNHQRRDRQTHEHEQSHQRRDRQTHEDKQNRQRRDRQTHEDEQ
NHQR
GenBank ID Protein 220776493
UniProtKB/Swiss-Prot ID Q6XPR3
UniProtKB/Swiss-Prot Entry Name RPTN_HUMAN
PDB IDs Not Available
GenBank Gene ID AL589986
GeneCard ID RPTN
GenAtlas ID RPTN
HGNC ID HGNC:26809
References
General References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  2. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  3. Huber M, Siegenthaler G, Mirancea N, Marenholz I, Nizetic D, Breitkreutz D, Mischke D, Hohl D: Isolation and characterization of human repetin, a member of the fused gene family of the epidermal differentiation complex. J Invest Dermatol. 2005 May;124(5):998-1007. [PubMed:15854042 ]