Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07975
Secondary Accession Numbers
  • 13686
Name Ryanodine receptor 2
Synonyms
  1. Cardiac muscle ryanodine receptor-calcium release channel
  2. Cardiac muscle-type ryanodine receptor
  3. RYR-2
  4. RyR2
  5. hRYR-2
Gene Name RYR2
Protein Type Unknown
Biological Properties
General Function Involved in calcium channel activity
Specific Function Communication between transverse-tubules and sarcoplasmic reticulum. Contraction of cardiac muscle is triggered by release of calcium ions from SR following depolarization of T- tubules
Pathways
  • Acebutolol Action Pathway
  • Alprenolol Action Pathway
  • Amiodarone Action Pathway
  • Amlodipine Action Pathway
  • Arbutamine Action Pathway
  • Atenolol Action Pathway
  • Betaxolol Action Pathway
  • Bevantolol Action Pathway
  • Bisoprolol Action Pathway
  • Bopindolol Action Pathway
  • Bupranolol Action Pathway
  • Carteolol Action Pathway
  • Carvedilol Action Pathway
  • Diltiazem Action Pathway
  • Disopyramide Action Pathway
  • Dobutamine Action Pathway
  • Epinephrine Action Pathway
  • Esmolol Action Pathway
  • Felodipine Action Pathway
  • Flecainide Action Pathway
  • Fosphenytoin (Antiarrhythmic) Action Pathway
  • Ibutilide Action Pathway
  • Isoprenaline Action Pathway
  • Isradipine Action Pathway
  • Labetalol Action Pathway
  • Levobunolol Action Pathway
  • Lidocaine (Antiarrhythmic) Action Pathway
  • Metipranolol Action Pathway
  • Metoprolol Action Pathway
  • Mexiletine Action Pathway
  • Muscle/Heart Contraction
  • Nadolol Action Pathway
  • Nebivolol Action Pathway
  • Nifedipine Action Pathway
  • Nimodipine Action Pathway
  • Nisoldipine Action Pathway
  • Nitrendipine Action Pathway
  • Oxprenolol Action Pathway
  • Penbutolol Action Pathway
  • Phenytoin (Antiarrhythmic) Action Pathway
  • Pindolol Action Pathway
  • Practolol Action Pathway
  • Procainamide (Antiarrhythmic) Action Pathway
  • Propranolol Action Pathway
  • Quinidine Action Pathway
  • Sotalol Action Pathway
  • Timolol Action Pathway
  • Tocainide Action Pathway
  • Verapamil Action Pathway
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
ion binding
cation binding
metal ion binding
binding
intracellular ligand-gated calcium channel activity
ryanodine-sensitive calcium-release channel activity
intracellular ligand-gated ion channel activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
calcium ion binding
calcium channel activity
ligand-gated ion channel activity
Process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
cellular metal ion homeostasis
cellular calcium ion homeostasis
establishment of localization
transport
biological regulation
transmembrane transport
ion transport
cation transport
regulation of biological quality
homeostatic process
chemical homeostasis
ion homeostasis
cellular ion homeostasis
cellular cation homeostasis
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Probable)
Gene Properties
Chromosome Location Chromosome:1
Locus 1q43
SNPs RYR2
Gene Sequence
>14904 bp
ATGGCCGATGGGGGCGAGGGCGAAGACGAGATCCAGTTCCTGCGAACTGATGATGAAGTG
GTTCTGCAGTGCACCGCAACCATCCACAAAGAACAACAGAAGCTATGCTTGGCAGCAGAA
GGATTTGGCAACAGACTTTGTTTCTTGGAGTCCACTTCCAATTCCAAGAATGTGCCCCCA
GACCTCTCCATCTGCACCTTTGTGCTGGAGCAGTCCCTCTCTGTCCGGGCGCTGCAGGAG
ATGCTGGCTAACACCGTGGAGAAATCAGAAGGGCAAGTTGATGTGGAAAAATGGAAATTC
ATGATGAAGACTGCTCAAGGTGGTGGTCATCGAACACTCCTCTACGGACATGCCATATTG
CTGCGCCATTCCTATAGTGGCATGTATCTGTGCTGCCTGTCCACCTCCCGGTCTTCAACT
GATAAGCTGGCTTTTGATGTTGGCTTGCAAGAGGACACCACAGGGGAGGCTTGTTGGTGG
ACCATACACCCTGCCTCTAAGCAGCGATCAGAAGGAGAAAAAGTACGAGTTGGAGATGAC
CTCATCTTAGTTAGCGTGTCCTCTGAAAGGTACTTGCACTTGTCTTATGGCAACGGCAGC
TTACACGTGGATGCCGCTTTCCAGCAGACTCTCTGGAGCGTGGCCCCAATCAGCTCAGGA
AGTGAGGCAGCCCAAGGGTATCTCATTGGTGGTGATGTCCTCAGGTTGCTGCATGGACAC
ATGGACGAGTGTCTCACTGTCCCTTCAGGAGAACATGGTGAAGAGCAGCGGAGAACTGTT
CATTATGAAGGTGGCGCTGTGTCTGTTCATGCACGTTCCCTTTGGAGACTAGAGACGCTA
AGAGTTGCGTGGAGTGGAAGCCACATAAGATGGGGACAGCCATTCCGACTACGCCATGTC
ACAACAGGAAAATACTTGAGTCTCATGGAAGACAAAAACCTTCTACTCATGGACAAAGAG
AAAGCTGATGTAAAATCAACAGCATTTACCTTCCGGTCTTCCAAGGAAAAATTGGATGTA
GGGGTGAGAAAAGAAGTAGATGGCATGGGAACATCTGAAATAAAATACGGTGACTCAGTA
TGCTATATACAACATGTAGACACAGGCCTATGGCTTACTTACCAGTCTGTGGACGTGAAA
TCCGTGAGAATGGGATCTATACAACGTAAGGCTATTATGCATCATGAAGGCCACATGGAT
GATGGCATAAGTTTGTCGAGATCCCAGCATGAAGAATCACGCACAGCCCGAGTTATCCGG
AGCACAGTCTTCCTTTTCAATAGATTTATAAGGGGCCTTGATGCTCTCAGCAAGAAAGCG
AAGGCTTCCACAGTCGATTTGCCTATAGAGTCCGTAAGCCTAAGTCTGCAGGATCTCATT
GGCTACTTCCACCCCCCAGATGAGCATTTAGAGCATGAAGACAAACAGAACAGACTACGA
GCCCTGAAGAATCGGCAAAATCTCTTCCAGGAAGAGGGAATGATCAACCTCGTGCTTGAG
TGCATAGACCGTTTGCACGTCTACAGCAGTGCAGCACACTTTGCTGATGTTGCTGGGCGA
GAAGCAGGAGAGTCTTGGAAATCCATTCTGAATTCTCTGTATGAGTTGCTGGCGGCTCTA
ATTAGAGGAAATCGTAAAAACTGTGCTCAATTTTCTGGCTCCCTCGACTGGTTGATCAGC
AGATTGGAAAGACTGGAAGCTTCTTCAGGCATTCTGGAAGTTTTACACTGTGTTTTAGTA
GAAAGTCCAGAAGCTCTAAATATTATTAAAGAAGGACATATTAAATCTATTATCTCACTT
TTAGACAAACATGGAAGAAATCACAAGGTTCTGGATGTCTTGTGCTCACTCTGTGTTTGC
CACGGGGTTGCAGTCCGTTCTAACCAGCATCTCATCTGTGACAATCTCCTACCAGGAAGA
GACTTGTTATTGCAGACACGTCTTGTGAACCATGTCAGCAGCATGAGACCCAATATTTTT
CTGGGCGTCAGTGAAGGTTCTGCTCAGTATAAGAAATGGTACTATGAATTGATGGTGGAC
CACACAGAGCCCTTTGTGACAGCTGAAGCAACTCACCTGCGAGTGGGCTGGGCTTCCACT
GAAGGATATTCTCCCTACCCTGGAGGGGGCGAAGAGTGGGGTGGAAATGGTGTTGGAGAT
GATCTCTTCTCCTATGGATTTGATGGCCTTCATCTCTGGTCAGGTTGTATTGCTCGTACT
GTAAGCTCACCAAACCAACATCTGTTAAGAACTGATGATGTCATCAGTTGCTGTTTAGAT
CTGAGTGCCCCAAGCATCTCGTTCCGAATTAATGGACAACCTGTTCAAGGAATGTTTGAG
AATTTCAACATCGATGGCCTCTTCTTTCCAGTCGTTAGTTTCTCTGCAGGAATAAAAGTA
CGCTTTCTGCTTGGAGGGCGACATGGAGAATTCAAATTTCTTCCTCCACCTGGGTATGCT
CCTTGTTATGAAGCTGTTCTGCCAAAAGAAAAGTTGAAAGTGGAACACAGCCGAGAGTAC
AAGCAAGAAAGAACTTACACACGCGACCTGCTGGGCCCCACAGTTTCCCTGACGCAAGCT
GCCTTCACACCCATCCCTGTGGATACCAGCCAGATCGTGTTGCCTCCTCATCTAGAAAGA
ATAAGAGAAAAACTGGCAGAGAATATCCATGAACTCTGGGTTATGAATAAAATTGAGCTT
GGCTGGCAGTATGGTCCGGTTAGAGATGACAACAAGAGACAACACCCATGCCTGGTGGAG
TTCTCCAAGCTGCCTGAACAGGAGCGCAATTACAACTTACAAATGTCGCTTGAGACCCTG
AAGACTTTGTTGGCATTAGGATGTCATGTGGGTATATCAGATGAACATGCTGAAGACAAG
GTGAAAAAAATGAAGCTACCCAAGAATTACCAGCTGACAAGTGGATACAAGCCTGCCCCT
ATGGACCTGAGCTTTATCAAACTCACCCCATCGCAAGAAGCAATGGTGGACAAGTTGGCA
GAAAATGCACATAATGTGTGGGCGCGGGATCGAATCCGGCAGGGCTGGACTTATGGCATC
CAACAGGACGTAAAGAACAGAAGAAATCCTCGCCTTGTTCCCTACACTCCTCTGGATGAC
CGAACCAAGAAATCCAACAAGGACAGCCTCCGCGAGGCTGTGCGCACGCTGCTGGGGTAC
GGCTACAACTTGGAAGCACCAGATCAAGATCATGCAGCCAGAGCCGAAGTGTGCAGCGGC
ACCGGGGAAAGGTTCCGAATCTTCCGTGCCGAGAAGACCTATGCAGTGAAGGCCGGACGG
TGGTATTTTGAATTTGAGACGGTCACTGCTGGAGACATGAGGGTTGGTTGGAGTCGTCCT
GGTTGTCAACCGGATCAGGAGCTTGGCTCAGATGAACGTGCCTTTGCCTTTGATGGCTTC
AAGGCCCAGCGGTGGCATCAGGGCAATGAACACTATGGGCGCTCTTGGCAAGCAGGCGAT
GTCGTGGGGTGTATGGTTGACATGAACGAACACACCATGATGTTCACACTGAATGGTGAA
ATCCTTCTTGATGATTCAGGCTCAGAACTGGCTTTCAAGGACTTTGATGTTGGCGATGGA
TTCATACCTGTGTGTAGCCTTGGAGTGGCTCAAGTGGGTAGGATGAACTTTGGAAAGGAT
GTCAGCACCTTGAAATATTTCACCATCTGTGGCTTACAAGAGGGCTATGAACCATTTGCC
GTTAATACAAACAGGGATATTACCATGTGGCTGAGCAAGAGGCTTCCTCAGTTTCTTCAA
GTTCCATCAAACCATGAACATATAGAGGTGACCAGAATAGACGGCACCATAGACAGTTCC
CCATGTTTAAAGGTCACTCAGAAGTCTTTTGGTTCTCAGAACAGCAACACTGATATCATG
TTTTATCGCCTGAGCATGCCGATCGAGTGCGCGGAGGTCTTCTCCAAGACGGTGGCTGGA
GGGCTCCCTGGGGCTGGCCTTTTTGGGCCCAAGAATGACTTGGAAGATTATGATGCTGAT
TCTGACTTTGAGGTTCTGATGAAGACAGCTCATGGCCATCTAGTGCCCGATCGTGTTGAC
AAAGACAAAGAAGCTACTAAACCAGAGTTTAACAACCACAAAGATTATGCCCAGGAAAAG
CCCTCTCGTCTGAAACAAAGATTTTTGCTTAGAAGAACAAAGCCAGATTACAGCACAAGC
CATTCTGCAAGACTCACCGAAGATGTCCTTGCTGATGATCGGGATGACTATGATTTCTTG
ATGCAAACGTCCACGTACTATTACTCAGTGAGAATCTTTCCTGGACAAGAACCTGCTAAT
GTCTGGGTGGGCTGGATTACATCAGATTTCCATCAGTATGACACAGGCTTTGACTTGGAC
AGAGTTCGCACAGTAACAGTTACTCTAGGAGATGAAAAAGGAAAAGTGCATGAAAGCATC
AAACGCAGCAACTGCTATATGGTATGTGCGGGTGAGAGCATGAGCCCCGGGCAAGGACGC
AACAATAATGGACTGGAGATTGGCTGTGTGGTGGATGCTGCCAGCGGGCTGCTCACATTC
ATTGCCAATGGCAAGGAACTGAGCACATACTATCAGGTGGAACCGAGTACAAAATTATTT
CCTGCGGTTTTTGCACAAGCTACAAGTCCCAATGTTTTCCAGTTTGAGTTGGGAAGAATA
AAGAATGTGATGCCTCTCTCGGCGGGATTATTCAAGAGTGAGCACAAGAACCCCGTGCCG
CAGTGCCCCCCGCGCCTCCACGTGCAGTTCCTGTCACACGTCCTGTGGAGCAGAATGCCC
AACCAGTTTTTGAAGGTAGATGTGTCTCGAATAAGTGAACGCCAAGGCTGGTTGGTGCAG
TGTTTGGATCCTCTGCAGTTCATGTCTCTTCATATCCCTGAGGAAAACAGATCTGTTGAC
ATCTTAGAGTTGACAGAGCAGGAGGAATTGCTGAAATTTCACTATCACACTCTCCGGCTC
TACTCAGCCGTCTGTGCTCTTGGGAACCACCGGGTGGCCCATGCCCTGTGCAGCCATGTG
GATGAACCTCAGCTCCTCTATGCCATTGAGAACAAGTACATGCCTGGTTTGCTGCGTGCT
GGCTACTATGACCTGCTGATTGACATCCACCTGAGCTCCTATGCCACTGCCAGGCTCATG
ATGAACAACGAGTACATTGTCCCCATGACGGAGGAGACGAAGAGCATCACCCTGTTCCCT
GATGAGAACAAAAAACACGGCCTTCCAGGGATCGGCCTCAGCACCTCCCTCAGGCCACGG
ATGCAGTTTTCCTCCCCCAGTTTTGTAAGCATTAGTAATGAATGTTACCAGTACAGTCCA
GAGTTCCCACTGGACATCCTCAAGTCCAAAACCATACAGATGCTGACAGAAGCTGTTAAA
GAGGGCAGTCTTCATGCCCGGGACCCAGTTGGAGGGACTACTGAATTCCTCTTTGTACCT
CTCATCAAGCTTTTCTATACCCTGCTGATCATGGGCATCTTTCACAACGAGGACTTGAAG
CACATCTTGCAGTTGATTGAGCCCAGTGTGTTTAAAGAAGCTGCCACTCCGGAGGAGGAG
AGTGACACGCTGGAGAAAGAGCTCAGTGTGGACGATGCAAAGCTGCAAGGAGCTGGTGAG
GAAGAAGCCAAGGGGGGCAAGCGGCCCAAGGAAGGCCTGCTCCAAATGAAACTGCCAGAG
CCAGTTAAATTGCAGATGTGCCTACTGCTTCAGTACCTCTGTGACTGCCAGGTCCGGCAC
CGGATAGAAGCCATTGTAGCCTTTTCAGATGATTTTGTGGCTAAGCTCCAAGACAATCAA
CGTTTCCGATACAACGAAGTCATGCAAGCCTTAAACATGTCAGCTGCACTCACAGCCAGG
AAGACAAAGGAATTTAGATCACCACCTCAAGAACAGATCAATATGCTTCTCAATTTTAAG
GATGACAAAAGTGAATGTCCATGTCCAGAAGAAATTCGTGACCAACTATTGGATTTCCAT
GAAGATTTGATGACACATTGTGGAATTGAGCTGGATGAAGATGGGTCTCTGGATGGAAAC
AGTGATTTAACAATTAGAGGGCGTCTGCTATCCCTGGTAGAAAAGGTGACATATCTGAAG
AAGAAGCAAGCAGAAAAACCAGTTGAGAGTGACTCCAAAAAGTCCTCCACTCTGCAGCAG
CTGATTTCTGAGACCATGGTCCGATGGGCTCAGGAGTCTGTCATTGAAGACCCCGAGCTG
GTGAGGGCCATGTTTGTGTTGCTCCATCGGCAGTATGACGGCATTGGGGGTCTTGTTCGG
GCCCTGCCAAAGACCTACACGATAAATGGTGTGTCCGTGGAGGACACCATCAACCTGCTG
GCATCCCTTGGTCAGATTCGGTCCCTGCTGAGTGTGAGAATGGGCAAAGAAGAAGAGAAG
CTCATGATTCGTGGATTAGGGGATATTATGAATAACAAAGTGTTTTACCAGCACCCTAAT
CTCATGAGGGCACTGGGGATGCACGAGACTGTGATGGAGGTCATGGTGAACGTCCTTGGA
GGTGGAGAGTCCAAGGAAATCACCTTTCCCAAGATGGTGGCCAACTGTTGCCGTTTTCTC
TGTTACTTCTGTCGTATAAGTAGGCAGAATCAAAAAGCTATGTTTGATCATCTCAGTTAT
TTACTGGAAAACAGCAGTGTTGGTCTTGCCTCCCCAGCTATGAGAGGTTCAACACCACTG
GATGTGGCTGCAGCTTCGGTGATGGATAATAATGAACTAGCATTAGCTCTGCGTGAGCCG
GATCTAGAAAAGGTAGTTCGTTATTTGGCTGGTTGTGGACTGCAAAGTTGCCAGATGCTG
GTGTCTAAGGGCTATCCAGACATTGGGTGGAACCCAGTTGAAGGAGAGAGATATCTTGAC
TTTCTCAGATTTGCTGTCTTCTGTAATGGGGAGAGTGTGGAGGAAAATGCAAATGTCGTG
GTGAGATTGCTCATTCGGAGGCCTGAGTGTTTTGGTCCTGCTTTGAGAGGAGAAGGTGGG
AATGGGCTTCTTGCAGCAATGGAAGAAGCCATCAAAATCGCCGAGGATCCTTCCCGAGAT
GGTCCCTCACCAAATAGCGGATCCAGTAAAACACTTGACACAGAGGAGGAGGAAGATGAC
ACTATCCACATGGGGAACGCGATCATGACCTTCTATTCAGCTTTGATTGACCTCTTGGGA
CGCTGTGCTCCTGAGATGCATTTGATTCATGCCGGGAAGGGAGAAGCCATCAGAATTAGG
TCCATTTTGAGATCCCTCATTCCCCTGGGAGATTTGGTGGGCGTTATCAGCATCGCTTTT
CAGATGCCAACAATAGCCAAAGATGGGAATGTGGTGGAACCTGACATGTCTGCGGGGTTT
TGCCCAGATCACAAGGCAGCCATGGTTTTATTCCTTGACAGGGTCTATGGGATTGAGGTT
CAAGACTTCCTCCTCCATCTTCTTGAGGTTGGCTTTCTGCCAGATCTCCGGGCGGCTGCT
TCTTTAGATACGGCAGCTTTGAGTGCTACAGACATGGCCTTGGCCCTCAATCGGTACCTT
TGCACAGCCGTCTTGCCATTGTTAACAAGATGTGCTCCTCTCTTTGCTGGCACAGAGCAC
CACGCTTCTCTCATTGACTCATTACTTCATACTGTGTATAGACTTTCTAAGGGCTGTTCA
CTTACCAAAGCTCAGCGGGATTCCATAGAAGTTTGTTTACTCTCTATTTGTGGACAACTG
AGACCTTCTATGATGCAGCACTTACTCAGAAGATTAGTATTTGATGTCCCATTATTAAAT
GAACACGCAAAGATGCCTCTTAAACTGCTGACAAATCATTATGAAAGATGCTGGAAATAT
TACTGCCTGCCTGGAGGGTGGGGAAACTTTGGTGCTGCCTCAGAAGAAGAACTTCATTTA
TCAAGAAAGTTGTTCTGGGGCATTTTTGATGCCCTGTCTCAAAAGAAATATGAACAAGAA
CTTTTCAAACTGGCACTGCCTTGCCTGAGTGCAGTTGCGGGAGCTTTGCCTCCAGACTAC
ATGGAGTCAAATTATGTCAGTATGATGGAAAAACAGTCATCAATGGATTCTGAAGGGAAC
TTTAACCCACAACCTGTTGATACCTCAAATATTACAATTCCTGAGAAATTGGAATACTTC
ATTAACAAATATGCAGAACACTCCCATGACAAATGGTCAATGGACAAGTTGGCAAATGGA
TGGATTTATGGAGAAATATATTCAGACTCTTCTAAGGTTCAGCCATTAATGAAGCCATAT
AAGCTATTGTCTGAAAAGGAAAAAGAAATTTATCGCTGGCCAATCAAAGAATCTTTAAAA
ACTATGCTGGCTAGGACTATGAGAACTGAAAGAACTCGGGAGGGAGACAGCATGGCCCTT
TACAACCGGACTCGTCGTATTTCTCAGACAAGCCAGGTTTCTGTGGACGCTGCCCATGGT
TACAGTCCCCGGGCCATTGACATGAGCAATGTTACACTATCTAGAGACCTGCATGCTATG
GCAGAAATGATGGCTGAAAACTACCATAATATATGGGCAAAGAAAAAGAAAATGGAGTTG
GAGTCCAAAGGAGGAGGAAACCATCCTCTGCTGGTGCCCTATGATACACTGACAGCCAAA
GAGAAAGCCAAGGATAGAGAAAAAGCACAGGACATCCTCAAGTTCTTGCAGATCAATGGA
TATGCTGTATCCAGAGGATTTAAGGACCTGGAACTGGACACGCCTTCTATTGAGAAACGA
TTTGCCTATAGTTTCCTCCAACAACTCATTCGCTATGTGGATGAAGCCCATCAGTATATC
CTGGAGTTTGATGGTGGCAGCAGAGGCAAAGGAGAACATTTCCCTTATGAACAAGAAATC
AAGTTCTTTGCAAAAGTCGTTCTTCCTTTAATTGATCAGTATTTCAAAAACCATCGTTTA
TACTTCTTATCTGCAGCAAGCAGACCTCTCTGCTCTGGAGGACATGCTTCCAACAAAGAG
AAAGAAATGGTGACTAGCCTATTCTGCAAACTTGGAGTTCTTGTCAGGCATAGGATTTCA
CTATTTGGCAATGATGCAACATCAATTGTCAACTGTCTTCATATTTTGGGTCAGACTTTG
GATGCAAGGACAGTGATGAAGACTGGCCTGGAGAGTGTTAAAAGTGCACTCAGAGCTTTT
CTGGACAACGCTGCAGAGGATCTGGAGAAGACCATGGAAAACCTCAAGCAGGGCCAGTTC
ACTCACACCCGAAACCAGCCCAAAGGGGTTACTCAGATTATCAATTACACCACAGTGGCC
CTGCTGCCAATGCTGTCGTCATTATTTGAACATATTGGCCAGCATCAGTTCGGAGAAGAC
CTAATATTGGAAGATGTCCAGGTGTCTTGTTATAGAATTCTGACTAGCTTATATGCTTTG
GGAACCAGCAAGAGTATTTACGTGGAGAGGCAACGTTCTGCATTAGGAGAATGTCTAGCT
GCCTTTGCTGGTGCTTTTCCTGTAGCATTTTTGGAAACTCATCTGGACAAACATAATATT
TACTCCATCTACAATACCAAGTCTTCACGAGAAAGAGCAGCTCTCAGTTTGCCAACTAAT
GTGGAAGATGTTTGTCCAAACATTCCGTCTTTGGAGAAACTCATGGAAGAAATCGTGGAA
TTAGCCGAGTCCGGCATTCGCTACACTCAAATGCCACATGTCATGGAAGTCATACTGCCC
ATGCTTTGCAGCTACATGTCTCGTTGGTGGGAGCATGGACCTGAGAACAATCCAGAACGG
GCCGAGATGTGCTGCACAGCCCTGAACTCAGAGCACATGAACACACTTCTAGGGAACATA
TTGAAAATCATATATAATAACTTGGGGATTGATGAGGGAGCCTGGATGAAGAGGCTAGCA
GTGTTTTCCCAGCCTATAATAAATAAAGTGAAACCTCAGCTCTTGAAAACTCATTTCTTG
CCGTTAATGGAGAAACTCAAGAAAAAGGCAGCTACGGTGGTGTCTGAGGAAGACCACCTG
AAAGCTGAGGCCAGGGGGGACATGTCGGAGGCAGAACTCCTCATCCTAGATGAGTTCACC
ACACTGGCCAGAGATCTCTATGCCTTCTACCCTCTCTTGATTAGATTTGTGGACTATAAC
AGGGCAAAGTGGCTAAAGGAGCCTAACCCAGAAGCAGAGGAGCTCTTCCGCATGGTGGCT
GAAGTGTTTATCTACTGGTCGAAGTCCCATAATTTCAAAAGAGAAGAGCAGAACTTCGTT
GTACAGAATGAAATCAACAATATGTCTTTCCTTATTACTGATACCAAGTCAAAGATGTCA
AAGGCAGCTGTTTCTGATCAGGAAAGGAAGAAAATGAAGCGCAAAGGAGATCGGTATTCC
ATGCAGACCTCTCTGATTGTAGCAGCTCTGAAGCGGTTACTGCCCATTGGGTTGAACATC
TGTGCCCCTGGGGACCAGGAGCTCATTGCTCTGGCCAAAAATCGATTTAGCCTGAAAGAT
ACTGAGGATGAAGTACGAGATATAATCCGCAGCAATATTCATTTACAAGGCAAGTTGGAG
GATCCTGCTATTAGATGGCAAATGGCTCTTTACAAAGACTTACCAAACAGGACTGATGAT
ACCTCAGATCCAGAGAAGACGGTAGAAAGAGTATTGGATATAGCAAATGTGCTTTTTCAT
CTTGAACAGAAGTCTAAACGTGTGGGTCGAAGACATTACTGTCTGGTGGAACATCCTCAG
AGATCTAAAAAGGCTGTATGGCATAAACTACTGTCTAAGCAGAGGAAAAGGGCTGTTGTA
GCCTGCTTCCGGATGGCCCCCTTATATAATCTGCCAAGGCATCGGGCTGTCAATCTCTTT
CTTCAGGGATATGAAAAGTCTTGGATTGAAACAGAAGAACATTACTTTGAAGATAAACTG
ATAGAAGATTTAGCAAAACCTGGGGCTGAACCTCCAGAAGAAGATGAAGGCACTAAGAGA
GTTGATCCTCTACATCAGCTGATCCTTCTGTTTAGTCGGACAGCTTTAACAGAGAAATGC
AAACTGGAGGAAGATTTTTTATATATGGCCTATGCAGATATTATGGCAAAGAGTTGTCAT
GATGAGGAAGATGACGATGGTGAAGAGGAAGTGAAGAGTTTTGAAGAAAAAGAAATGGAA
AAGCAAAAGCTTCTATACCAGCAAGCCCGACTCCACGATCGTGGCGCGGCTGAGATGGTG
CTACAGACAATCAGTGCCAGCAAAGGTGAAACTGGACCAATGGTAGCAGCTACTCTGAAA
CTTGGAATTGCTATTTTAAATGGTGGGAACTCCACAGTACAGCAGAAAATGCTTGACTAC
CTCAAGGAGAAAAAGGATGTGGGCTTCTTTCAGAGCCTGGCCGGCCTGATGCAGTCATGT
AGTGTCCTTGACCTAAATGCATTTGAGCGACAAAACAAAGCTGAAGGTCTTGGGATGGTG
ACAGAGGAAGGATCAGGAGAAAAGGTTCTGCAGGACGATGAGTTCACCTGTGACCTCTTC
CGATTCCTGCAACTACTCTGTGAGGGACACAACTCAGATTTTCAGAATTATCTGAGAACT
CAGACTGGCAATAATACAACTGTCAACATAATTATCTCCACTGTAGACTACCTACTGAGA
GTTCAGGAATCAATTAGTGACTTTTATTGGTATTACTCTGGGAAAGATGTTATTGATGAA
CAAGGACAACGGAATTTCTCCAAAGCTATCCAAGTGGCAAAACAAGTCTTTAACACTCTT
ACAGAGTATATTCAGGGTCCTTGCACTGGGAATCAACAGAGTTTGGCACACAGCAGGCTG
TGGGATGCTGTGGTCGGCTTTCTTCATGTGTTTGCCCATATGCAGATGAAGCTGTCGCAG
GATTCCAGTCAAATTGAGCTATTAAAAGAATTAATGGATCTGCAGAAGGATATGGTGGTC
ATGTTGCTGTCCATGTTAGAAGGTAATGTTGTTAATGGAACGATTGGCAAACAGATGGTG
GATATGCTTGTGGAATCTTCCAACAACGTGGAGATGATTCTCAAATTTTTTGACATGTTC
TTAAAACTAAAGGATTTGACGTCGTCTGATACTTTTAAAGAATATGACCCCGATGGCAAG
GGAGTCATTTCCAAGAGGGACTTCCACAAAGCGATGGAGAGCCATAAGCACTACACGCAG
TCAGAAACGGAATTTCTTTTGTCTTGTGCGGAGACGGATGAGAATGAAACCCTCGACTAC
GAAGAGTTCGTCAAACGCTTCCACGAACCTGCGAAGGACATCGGCTTCAACGTCGCCGTC
CTTCTGACAAACCTCTCTGAGCACATGCCCAACGATACCCGACTTCAGACTTTTCTGGAA
TTAGCAGAGAGCGTCCTGAATTATTTCCAGCCCTTTCTGGGCCGCATCGAAATCATGGGA
AGCGCCAAACGCATCGAGAGGGTCTATTTTGAAATCAGTGAGTCCAGCCGAACCCAGTGG
GAGAAGCCCCAGGTCAAGGAGTCCAAAAGACAGTTCATATTTGACGTGGTCAACGAAGGC
GGAGAGAAAGAGAAGATGGAACTCTTTGTGAACTTCTGCGAGGACACCATCTTTGAAATG
CAGCTGGCGGCTCAGATCTCGGAGTCGGACTTGAACGAGAGGTCAGCGAATAAGGAAGAA
AGCGAGAAGGAGAGGCCGGAAGAGCAGGGGCCGAGGATGGCTTTCTTCTCCATTCTGACG
GTCAGGTCGGCCCTGTTTGCGCTCAGGTACAATATCTTGACCCTTATGCGAATGCTCAGT
CTGAAGAGCCTGAAGAAGCAGATGAAAAAAGTAAAAAAGATGACCGTGAAGGACATGGTC
ACGGCCTTCTTTTCATCCTACTGGAGTATTTTCATGACCCTCTTGCACTTCGTGGCCAGC
GTTTTCAGAGGCTTTTTCCGCATCATTTGCAGCCTGCTGCTTGGGGGAAGCCTCGTCGAA
GGTGCTAAAAAGATCAAAGTTGCAGAACTGTTAGCCAACATGCCAGACCCCACTCAGGAT
GAGGTTAGAGGAGATGGGGAGGAGGGAGAGAGGAAACCCCTGGAAGCCGCCCTGCCCTCC
GAGGATCTGACCGACTTAAAGGAGCTGACAGAGGAAAGTGACCTTCTTTCGGACATCTTT
GGCCTGGATCTGAAGAGAGAAGGAGGACAGTACAAACTGATTCCTCATAATCCAAATGCT
GGGCTCAGTGACCTCATGAGCAACCCAGTCCCCATGCCTGAGGTGCAGGAAAAATTTCAG
GAACAGAAGGCAAAAGAAGAAGAAAAGGAAGAAAAAGAAGAAACCAAATCTGAACCTGAA
AAAGCCGAGGGAGAAGATGGAGAAAAAGAAGAGAAAGCCAAGGAAGACAAGGGCAAACAA
AAGTTGAGGCAGCTTCACACACACAGATACGGAGAACCAGAAGTGCCAGAGTCAGCATTC
TGGAAGAAAATCATAGCATATCAACAGAAACTTCTAAACTATTTTGCTCGCAACTTTTAC
AACATGAGAATGTTAGCCTTATTTGTCGCATTTGCTATCAATTTCATCTTGCTCTTTTAT
AAGGTCTCCACTTCTTCTGTGGTTGAAGGAAAGGAGCTCCCCACGAGAAGTTCAAGTGAA
AATGCCAAAGTGACAAGCCTGGACAGCAGCTCCCATAGAATCATCGCAGTTCACTATGTA
CTAGAGGAGAGCAGCGGCTACATGGAGCCCACGTTGCGTATCTTAGCTATTCTGCACACG
GTCATTTCTTTCTTCTGCATCATTGGATACTACTGCTTGAAAGTCCCATTGGTTATTTTT
AAGCGAGAAAAGGAAGTGGCACGGAAATTGGAATTTGATGGGCTTTATATTACAGAACAG
CCTTCAGAAGATGATATTAAAGGCCAGTGGGATAGACTCGTAATCAACACACAGTCATTT
CCCAACAACTACTGGGACAAATTTGTTAAAAGAAAGGTTATGGATAAATATGGAGAGTTC
TACGGCCGAGACAGAATCAGTGAATTACTTGGCATGGACAAGGCAGCTCTGGACTTCAGT
GATGCCAGAGAAAAGAAGAAGCCAAAGAAAGACAGCTCCTTATCAGCTGTACTGAACTCC
ATTGATGTGAAGTATCAGATGTGGAAACTAGGAGTCGTTTTCACTGACAACTCCTTCCTC
TACCTAGCCTGGTATATGACTATGTCTGTTCTTGGACACTATAACAACTTTTTTTTTGCC
GCTCACCTTCTCGACATTGCTATGGGATTCAAGACATTAAGAACCATCTTGTCCTCAGTA
ACTCACAATGGCAAACAGCTCGTATTAACCGTTGGCTTATTAGCTGTTGTTGTATACCTA
TACACTGTGGTGGCATTCAATTTTTTCCGAAAATTCTACAATAAAAGTGAAGATGGTGAT
ACACCAGATATGAAATGTGACGATATGCTAACATGCTATATGTTCCACATGTATGTTGGA
GTTCGTGCTGGAGGAGGGATCGGGGATGAAATCGAAGACCCAGCAGGAGATGAATATGAG
ATCTATCGAATCATCTTTGACATCACTTTCTTCTTCTTTGTTATTGTCATTCTCTTGGCC
ATAATACAAGGTCTAATTATTGATGCTTTTGGAGAACTAAGAGACCAACAGGAACAAGTC
AAAGAAGACATGGAGACCAAATGCTTCATCTGTGGGATAGGCAATGATTACTTCGACACA
GTGCCACATGGCTTTGAAACCCACACTTTACAGGAGCACAACTTGGCTAATTACTTGTTT
TTTCTGATGTATCTTATAAACAAAGATGAAACAGAACACACAGGACAGGAATCTTATGTC
TGGAAGATGTATCAAGAAAGGTGTTGGGAATTTTTCCCAGCAGGGGATTGCTTCCGGAAA
CAGTATGAAGACCAGCTAAATTAA
Protein Properties
Number of Residues 4967
Molecular Weight 564562.7
Theoretical pI 5.98
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 3090-3109
  • 3153-3171
  • 3940-3959
  • 3978-3995
  • 4233-4256
  • 4294-4314
  • 4500-4520
  • 4578-4600
  • 4720-4740
  • 4768-4786
  • 4810-4827
  • 4845-4867
Protein Sequence
>Ryanodine receptor 2
MADGGEGEDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPP
DLSICTFVLEQSLSVRALQEMLANTVEKSEGQVDVEKWKFMMKTAQGGGHRTLLYGHAIL
LRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDD
LILVSVSSERYLHLSYGNGSLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGH
MDECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHV
TTGKYLSLMEDKNLLLMDKEKADVKSTAFTFRSSKEKLDVGVRKEVDGMGTSEIKYGDSV
CYIQHVDTGLWLTYQSVDVKSVRMGSIQRKAIMHHEGHMDDGISLSRSQHEESRTARVIR
STVFLFNRFIRGLDALSKKAKASTVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLR
ALKNRQNLFQEEGMINLVLECIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAAL
IRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISL
LDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIF
LGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGD
DLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFE
NFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREY
KQERTYTRDLLGPTVSLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIEL
GWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGISDEHAEDK
VKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGI
QQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAARAEVCSG
TGERFRIFRAEKTYAVKAGRWYFEFETVTAGDMRVGWSRPGCQPDQELGSDERAFAFDGF
KAQRWHQGNEHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDG
FIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQ
VPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNSNTDIMFYRLSMPIECAEVFSKTVAG
GLPGAGLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRVDKDKEATKPEFNNHKDYAQEK
PSRLKQRFLLRRTKPDYSTSHSARLTEDVLADDRDDYDFLMQTSTYYYSVRIFPGQEPAN
VWVGWITSDFHQYDTGFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGR
NNNGLEIGCVVDAASGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRI
KNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQ
CLDPLQFMSLHIPEENRSVDILELTEQEELLKFHYHTLRLYSAVCALGNHRVAHALCSHV
DEPQLLYAIENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNNEYIVPMTEETKSITLFP
DENKKHGLPGIGLSTSLRPRMQFSSPSFVSISNECYQYSPEFPLDILKSKTIQMLTEAVK
EGSLHARDPVGGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSVFKEAATPEEE
SDTLEKELSVDDAKLQGAGEEEAKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRH
RIEAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNFK
DDKSECPCPEEIRDQLLDFHEDLMTHCGIELDEDGSLDGNSDLTIRGRLLSLVEKVTYLK
KKQAEKPVESDSKKSSTLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVR
ALPKTYTINGVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPN
LMRALGMHETVMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSY
LLENSSVGLASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQML
VSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGG
NGLLAAMEEAIKIAEDPSRDGPSPNSGSSKTLDTEEEEDDTIHMGNAIMTFYSALIDLLG
RCAPEMHLIHAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGNVVEPDMSAGF
CPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYL
CTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQL
RPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHL
SRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGN
FNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPY
KLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSVDAAHG
YSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKMELESKGGGNHPLLVPYDTLTAK
EKAKDREKAQDILKFLQINGYAVSRGFKDLELDTPSIEKRFAYSFLQQLIRYVDEAHQYI
LEFDGGSRGKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKE
KEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLESVKSALRAF
LDNAAEDLEKTMENLKQGQFTHTRNQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGED
LILEDVQVSCYRILTSLYALGTSKSIYVERQRSALGECLAAFAGAFPVAFLETHLDKHNI
YSIYNTKSSRERAALSLPTNVEDVCPNIPSLEKLMEEIVELAESGIRYTQMPHVMEVILP
MLCSYMSRWWEHGPENNPERAEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLA
VFSQPIINKVKPQLLKTHFLPLMEKLKKKAATVVSEEDHLKAEARGDMSEAELLILDEFT
TLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQNFV
VQNEINNMSFLITDTKSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNI
CAPGDQELIALAKNRFSLKDTEDEVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNRTDD
TSDPEKTVERVLDIANVLFHLEQKSKRVGRRHYCLVEHPQRSKKAVWHKLLSKQRKRAVV
ACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGAEPPEEDEGTKR
VDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEEKEME
KQKLLYQQARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDY
LKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLF
RFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDE
QGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQ
DSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMF
LKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDY
EEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMG
SAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEM
QLAAQISESDLNERSANKEESEKERPEEQGPRMAFFSILTVRSALFALRYNILTLMRMLS
LKSLKKQMKKVKKMTVKDMVTAFFSSYWSIFMTLLHFVASVFRGFFRIICSLLLGGSLVE
GAKKIKVAELLANMPDPTQDEVRGDGEEGERKPLEAALPSEDLTDLKELTEESDLLSDIF
GLDLKREGGQYKLIPHNPNAGLSDLMSNPVPMPEVQEKFQEQKAKEEEKEEKEETKSEPE
KAEGEDGEKEEKAKEDKGKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLLNYFARNFY
NMRMLALFVAFAINFILLFYKVSTSSVVEGKELPTRSSSENAKVTSLDSSSHRIIAVHYV
LEESSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQ
PSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFS
DAREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFA
AHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGD
TPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLA
IIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLF
FLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
GenBank ID Protein 1526978
UniProtKB/Swiss-Prot ID Q92736
UniProtKB/Swiss-Prot Entry Name RYR2_HUMAN
PDB IDs Not Available
GenBank Gene ID X98330
GeneCard ID RYR2
GenAtlas ID RYR2
HGNC ID HGNC:10484
References
General References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  2. Laitinen PJ, Swan H, Kontula K: Molecular genetics of exercise-induced polymorphic ventricular tachycardia: identification of three novel cardiac ryanodine receptor mutations and two common calsequestrin 2 amino-acid polymorphisms. Eur J Hum Genet. 2003 Nov;11(11):888-91. [PubMed:14571276 ]
  3. Martin C, Chapman KE, Seckl JR, Ashley RH: Partial cloning and differential expression of ryanodine receptor/calcium-release channel genes in human tissues including the hippocampus and cerebellum. Neuroscience. 1998 Jul;85(1):205-16. [PubMed:9607712 ]
  4. Tunwell RE, Wickenden C, Bertrand BM, Shevchenko VI, Walsh MB, Allen PD, Lai FA: The human cardiac muscle ryanodine receptor-calcium release channel: identification, primary structure and topological analysis. Biochem J. 1996 Sep 1;318 ( Pt 2):477-87. [PubMed:8809036 ]
  5. Tiso N, Stephan DA, Nava A, Bagattin A, Devaney JM, Stanchi F, Larderet G, Brahmbhatt B, Brown K, Bauce B, Muriago M, Basso C, Thiene G, Danieli GA, Rampazzo A: Identification of mutations in the cardiac ryanodine receptor gene in families affected with arrhythmogenic right ventricular cardiomyopathy type 2 (ARVD2). Hum Mol Genet. 2001 Feb 1;10(3):189-94. [PubMed:11159936 ]
  6. Awad SS, Lamb HK, Morgan JM, Dunlop W, Gillespie JI: Differential expression of ryanodine receptor RyR2 mRNA in the non-pregnant and pregnant human myometrium. Biochem J. 1997 Mar 15;322 ( Pt 3):777-83. [PubMed:9148749 ]
  7. Priori SG, Napolitano C, Tiso N, Memmi M, Vignati G, Bloise R, Sorrentino V, Danieli GA: Mutations in the cardiac ryanodine receptor gene (hRyR2) underlie catecholaminergic polymorphic ventricular tachycardia. Circulation. 2001 Jan 16;103(2):196-200. [PubMed:11208676 ]
  8. Laitinen PJ, Brown KM, Piippo K, Swan H, Devaney JM, Brahmbhatt B, Donarum EA, Marino M, Tiso N, Viitasalo M, Toivonen L, Stephan DA, Kontula K: Mutations of the cardiac ryanodine receptor (RyR2) gene in familial polymorphic ventricular tachycardia. Circulation. 2001 Jan 30;103(4):485-90. [PubMed:11157710 ]
  9. Priori SG, Napolitano C, Memmi M, Colombi B, Drago F, Gasparini M, DeSimone L, Coltorti F, Bloise R, Keegan R, Cruz Filho FE, Vignati G, Benatar A, DeLogu A: Clinical and molecular characterization of patients with catecholaminergic polymorphic ventricular tachycardia. Circulation. 2002 Jul 2;106(1):69-74. [PubMed:12093772 ]
  10. Bauce B, Rampazzo A, Basso C, Bagattin A, Daliento L, Tiso N, Turrini P, Thiene G, Danieli GA, Nava A: Screening for ryanodine receptor type 2 mutations in families with effort-induced polymorphic ventricular arrhythmias and sudden death: early diagnosis of asymptomatic carriers. J Am Coll Cardiol. 2002 Jul 17;40(2):341-9. [PubMed:12106942 ]
  11. Choi G, Kopplin LJ, Tester DJ, Will ML, Haglund CM, Ackerman MJ: Spectrum and frequency of cardiac channel defects in swimming-triggered arrhythmia syndromes. Circulation. 2004 Oct 12;110(15):2119-24. Epub 2004 Oct 4. [PubMed:15466642 ]
  12. Bagattin A, Veronese C, Rampazzo A, Danieli GA: Gene symbol: RYR2. Disease: Effort-induced polymorphic ventricular arrhythmias. Hum Genet. 2004 Mar;114(4):404. [PubMed:15046072 ]
  13. Bagattin A, Veronese C, Rampazzo A, Danieli GA: Gene symbol: RYR2. Disease: Effort-induced polymorphic ventricular arrhythmias. Hum Genet. 2004 Mar;114(4):405. [PubMed:15046073 ]
  14. Tester DJ, Spoon DB, Valdivia HH, Makielski JC, Ackerman MJ: Targeted mutational analysis of the RyR2-encoded cardiac ryanodine receptor in sudden unexplained death: a molecular autopsy of 49 medical examiner/coroner's cases. Mayo Clin Proc. 2004 Nov;79(11):1380-4. [PubMed:15544015 ]
  15. Jiang D, Chen W, Wang R, Zhang L, Chen SR: Loss of luminal Ca2+ activation in the cardiac ryanodine receptor is associated with ventricular fibrillation and sudden death. Proc Natl Acad Sci U S A. 2007 Nov 13;104(46):18309-14. Epub 2007 Nov 1. [PubMed:17984046 ]