You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07978
Secondary Accession Numbers
  • 13689
Name Protein S100-P
Synonyms
  1. Protein S100-E
  2. S100 calcium-binding protein P
Gene Name S100P
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:4
Locus 4p16
SNPs S100P
Gene Sequence
>288 bp
ATGACGGAACTAGAGACAGCCATGGGCATGATCATAGACGTCTTTTCCCGATATTCGGGC
AGCGAGGGCAGCACGCAGACCCTGACCAAGGGGGAGCTCAAGGTGCTGATGGAGAAGGAG
CTACCAGGCTTCCTGCAGAGTGGAAAAGACAAGGATGCCGTGGATAAATTGCTCAAGGAC
CTGGACGCCAATGGAGATGCCCAGGTGGACTTCAGTGAGTTCATCGTGTTCGTGGCTGCA
ATCACGTCTGCCTGTCACAAGTACTTTGAGAAGGCAGGACTCAAATGA
Protein Properties
Number of Residues 95
Molecular Weight 10399.8
Theoretical pI 4.5
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Protein S100-P
MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKD
LDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
GenBank ID Protein 28376391
UniProtKB/Swiss-Prot ID P25815
UniProtKB/Swiss-Prot Entry Name S100P_HUMAN
PDB IDs
GenBank Gene ID AF539739
GeneCard ID S100P
GenAtlas ID S100P
HGNC ID HGNC:10504
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Becker T, Gerke V, Kube E, Weber K: S100P, a novel Ca(2+)-binding protein from human placenta. cDNA cloning, recombinant protein expression and Ca2+ binding properties. Eur J Biochem. 1992 Jul 15;207(2):541-7. [PubMed:1633809 ]
  3. Emoto Y, Kobayashi R, Akatsuka H, Hidaka H: Purification and characterization of a new member of the S-100 protein family from human placenta. Biochem Biophys Res Commun. 1992 Feb 14;182(3):1246-53. [PubMed:1540168 ]
  4. Dowen SE, Crnogorac-Jurcevic T, Gangeswaran R, Hansen M, Eloranta JJ, Bhakta V, Brentnall TA, Luttges J, Kloppel G, Lemoine NR: Expression of S100P and its novel binding partner S100PBPR in early pancreatic cancer. Am J Pathol. 2005 Jan;166(1):81-92. [PubMed:15632002 ]
  5. Zhang H, Wang G, Ding Y, Wang Z, Barraclough R, Rudland PS, Fernig DG, Rao Z: The crystal structure at 2A resolution of the Ca2+ -binding protein S100P. J Mol Biol. 2003 Jan 24;325(4):785-94. [PubMed:12507480 ]