You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07989
Secondary Accession Numbers
  • 13700
Name Sarcolipin
Synonyms Not Available
Gene Name SLN
Protein Type Unknown
Biological Properties
General Function Involved in enzyme regulator activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
enzyme regulator activity
Cellular Location
  1. Single-pass membrane protein
  2. Sarcoplasmic reticulum membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 11q22-q23
SNPs SLN
Gene Sequence
>96 bp
ATGGGGATAAACACCCGGGAGCTGTTTCTCAACTTCACTATTGTCTTGATTACGGTTATT
CTTATGTGGCTCCTTGTGAGGTCCTATCAGTACTGA
Protein Properties
Number of Residues 31
Molecular Weight 3761.6
Theoretical pI 9.17
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 8-25
Protein Sequence
>Sarcolipin
MGINTRELFLNFTIVLITVILMWLLVRSYQY
GenBank ID Protein 2642411
UniProtKB/Swiss-Prot ID O00631
UniProtKB/Swiss-Prot Entry Name SARCO_HUMAN
PDB IDs
GenBank Gene ID U96093
GeneCard ID SLN
GenAtlas ID SLN
HGNC ID HGNC:11089
References
General References
  1. Odermatt A, Taschner PE, Scherer SW, Beatty B, Khanna VK, Cornblath DR, Chaudhry V, Yee WC, Schrank B, Karpati G, Breuning MH, Knoers N, MacLennan DH: Characterization of the gene encoding human sarcolipin (SLN), a proteolipid associated with SERCA1: absence of structural mutations in five patients with Brody disease. Genomics. 1997 Nov 1;45(3):541-53. [PubMed:9367679 ]
  2. Mascioni A, Karim C, Barany G, Thomas DD, Veglia G: Structure and orientation of sarcolipin in lipid environments. Biochemistry. 2002 Jan 15;41(2):475-82. [PubMed:11781085 ]